Recombinant Human GluR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GluR1 Protein Summary

Description
GluR1 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRIA1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GluR1 Protein

  • AMPA 1
  • AMPA-selective glutamate receptor 1
  • GluA1
  • GLUH1
  • GluR1
  • gluR-1
  • GLUR1gluR-A
  • GLURA
  • GluR-A
  • gluR-K1
  • glutamate receptor 1
  • Glutamate receptor ionotropic, AMPA 1
  • glutamate receptor, ionotropic, AMPA 1
  • GRIA1
  • HBGR1
  • MGC133252

Background

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The GRIA1 belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Each of the members (GRIA1-4) include flip and flop isoforms generated by alternative RNA splicing. The receptor subunits encoded by each isoform vary in their signal transduction properties. The isoform presented here is the flop isoform. In situ hybridization experiments showed that human GRIA1 mRNA is present in granule and pyramidal cells in the hippocampal formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-02312
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
NBP2-37584
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002890-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GluR1 Partial Recombinant Protein (H00002890-Q01) (0)

There are no publications for GluR1 Partial Recombinant Protein (H00002890-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GluR1 Partial Recombinant Protein (H00002890-Q01) (0)

There are no reviews for GluR1 Partial Recombinant Protein (H00002890-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GluR1 Partial Recombinant Protein (H00002890-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GluR1 Products

Bioinformatics Tool for GluR1 Partial Recombinant Protein (H00002890-Q01)

Discover related pathways, diseases and genes to GluR1 Partial Recombinant Protein (H00002890-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GluR1 Partial Recombinant Protein (H00002890-Q01)

Discover more about diseases related to GluR1 Partial Recombinant Protein (H00002890-Q01).
 

Pathways for GluR1 Partial Recombinant Protein (H00002890-Q01)

View related products by pathway.

PTMs for GluR1 Partial Recombinant Protein (H00002890-Q01)

Learn more about PTMs related to GluR1 Partial Recombinant Protein (H00002890-Q01).
 

Research Areas for GluR1 Partial Recombinant Protein (H00002890-Q01)

Find related products by research area.

Blogs on GluR1

There are no specific blogs for GluR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
BDNF [Unconjugated]
248-BD-005/CF
NMDAR2B Antibody
NB300-106-100ul
NMDAR2B Antibody
NB300-106-100ul

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GluR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIA1
Entrez