Recombinant Human GluR1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GluR1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 201-300 of Human GluR1

Source: Wheat Germ

Amino Acid Sequence: VVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRIA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GluR1 Protein

  • AMPA 1
  • AMPA-selective glutamate receptor 1
  • GluA1
  • GLUH1
  • GluR1
  • gluR-1
  • GLUR1gluR-A
  • GLURA
  • GluR-A
  • gluR-K1
  • glutamate receptor 1
  • Glutamate receptor ionotropic, AMPA 1
  • glutamate receptor, ionotropic, AMPA 1
  • GRIA1
  • HBGR1
  • MGC133252

Background

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The GRIA1 belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Each of the members (GRIA1-4) include flip and flop isoforms generated by alternative RNA splicing. The receptor subunits encoded by each isoform vary in their signal transduction properties. The isoform presented here is the flop isoform. In situ hybridization experiments showed that human GRIA1 mRNA is present in granule and pyramidal cells in the hippocampal formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-02312
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP2-37584
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu
Applications: WB, IHC, IHC-P
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP2-24940
Species: Hu, Ye
Applications: WB
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP1-88227
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91857
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GluR1 Partial Recombinant Protein (H00002890-Q01) (0)

There are no publications for GluR1 Partial Recombinant Protein (H00002890-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GluR1 Partial Recombinant Protein (H00002890-Q01) (0)

There are no reviews for GluR1 Partial Recombinant Protein (H00002890-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GluR1 Partial Recombinant Protein (H00002890-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GluR1 Partial Recombinant Protein (H00002890-Q01)

Discover related pathways, diseases and genes to GluR1 Partial Recombinant Protein (H00002890-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GluR1 Partial Recombinant Protein (H00002890-Q01)

Discover more about diseases related to GluR1 Partial Recombinant Protein (H00002890-Q01).
 

Pathways for GluR1 Partial Recombinant Protein (H00002890-Q01)

View related products by pathway.

PTMs for GluR1 Partial Recombinant Protein (H00002890-Q01)

Learn more about PTMs related to GluR1 Partial Recombinant Protein (H00002890-Q01).
 

Research Areas for GluR1 Partial Recombinant Protein (H00002890-Q01)

Find related products by research area.

Blogs on GluR1

There are no specific blogs for GluR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GluR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIA1
Entrez