Glucose 6 phosphate isomerase Antibody - BSA Free

Western Blot: Glucose 6 phosphate isomerase Antibody [NBP2-58524] - Analysis NBP2-58524 (A) shows similar pattern to independent antibody NBP1-90177 (B).

Western Blot: Glucose 6 phosphate isomerase Antibody [NBP2-58524] - Analysis in human cell line A-549 and human cell line SK-MEL-30.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glucose 6 phosphate isomerase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glucose 6 phosphate isomerase Antibody - BSA Free (NBP2-58524) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALST
• Predicted Species: Mouse (93%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPI
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glucose 6 phosphate isomerase Recombinant Protein Antigen (NBP2-58524PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glucose 6 phosphate isomerase Antibody - BSA Free

• AMFGNPI
• Autocrine motility factor
• DKFZp686C13233
• EC 5.3.1.9
• glucose phosphate isomerase
• glucose-6-phosphate isomerase
• hexose monophosphate isomerase
• hexosephosphate isomerase
• neuroleukin
• NLKSA36
• oxoisomerase
• PGI
• PHI
• Phosphoglucose isomerase
• phosphohexomutase
• Phosphohexose isomerase
• phosphosaccharomutase
• SA-36
• Sperm antigen 36
• sperm antigen-36

Background

Glucose 6 phosphate isomerase belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPI