Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody

Images

 
Western Blot: Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody [NBP3-10177] - Western blot analysis of Glucose 6 Phosphate 1-Dehydrogenase 2 in Mouse Small Intestine lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse Glucose 6 Phosphate 1-Dehydrogenase 2 (NP_062341.2). Peptide sequence QYDDPASYKHLNSYINALHQGMQANHLFYLALPPTVYEAVTKNIQETCMS
Clonality
Polyclonal
Host
Rabbit
Gene
G6pd2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody

  • GPD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45880
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NBP1-31225
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32259
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
H00051776-M03
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP3-10177
Species: Mu
Applications: WB

Publications for Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody (NBP3-10177) (0)

There are no publications for Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody (NBP3-10177).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody (NBP3-10177) (0)

There are no reviews for Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody (NBP3-10177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody (NBP3-10177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucose 6 Phosphate 1-Dehydrogenase 2 Products

Bioinformatics Tool for Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody (NBP3-10177)

Discover related pathways, diseases and genes to Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody (NBP3-10177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody (NBP3-10177)

View related products by pathway.

Blogs on Glucose 6 Phosphate 1-Dehydrogenase 2

There are no specific blogs for Glucose 6 Phosphate 1-Dehydrogenase 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucose 6 Phosphate 1-Dehydrogenase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol G6pd2