Glucagon Antibody - BSA Free

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Analysis in human pancreas and skeletal muscle tissues. Corresponding GCG RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human colon, pancreas, skeletal muscle and small intestine using Anti-GCG antibody NBP2-38329 (A) shows similar protein distribution across tissues to independent antibody NBP2-38330 (B).

Immunocytochemistry/Immunofluorescence: Glucagon Antibody [NBP2-38329] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human pancreas shows strong cytoplasmic positivity in endocrine glandular cells.

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.

Immunohistochemistry-Paraffin: Glucagon Antibody [NBP2-38329] - Staining of human colon shows moderate cytoplasmic positivity in enteroendocrine cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Glucagon Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glucagon Antibody - BSA Free (NBP2-38329) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  Glucagon Recombinant Protein Antigen (NBP2-38329PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Glucagon Antibody - BSA Free

• GCG
• glicentin-related polypeptide
• GLP1
• GLP-1
• Glucagon
• glucagon-like peptide 1
• glucagon-like peptide 2
• GRPP

Background

The protein encoded by the Glucagon gene is actually a preproprotein that is cleaved into four distinct mature peptides. One ofthese, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulatingglycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signallingpathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promotenutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an activeenteroglucagon. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GCG
• Uniprot:
  • P01275()