Secretin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Secretin Antibody [NBP2-48988] - Staining in human duodenum and liver tissues using anti-SCT antibody. Corresponding SCT RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Secretin Antibody [NBP2-48988] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Secretin Antibody [NBP2-48988] - Staining of human duodenum shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Secretin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Secretin Recombinant Protein Antigen (NBP2-48988PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Secretin Antibody

  • secretin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-46349
Species: Hu
Applications: IHC, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-1793
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB8864
Species: Hu
Applications: IHC
AF6380
Species: Mu
Applications: WB
NBP3-03282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93868
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-92287
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-04850
Species: Hu, Mu, Rt
Applications: WB
NBP2-44318
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-76626
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-48988
Species: Hu
Applications: IHC, IHC-P

Publications for Secretin Antibody (NBP2-48988) (0)

There are no publications for Secretin Antibody (NBP2-48988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Secretin Antibody (NBP2-48988) (0)

There are no reviews for Secretin Antibody (NBP2-48988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Secretin Antibody (NBP2-48988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Secretin Products

Bioinformatics Tool for Secretin Antibody (NBP2-48988)

Discover related pathways, diseases and genes to Secretin Antibody (NBP2-48988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Secretin Antibody (NBP2-48988)

Discover more about diseases related to Secretin Antibody (NBP2-48988).
 

Pathways for Secretin Antibody (NBP2-48988)

View related products by pathway.

Research Areas for Secretin Antibody (NBP2-48988)

Find related products by research area.

Blogs on Secretin

There are no specific blogs for Secretin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Secretin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCT