GLIS3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GLIS3 Antibody [NBP2-33787] - Staining of human cell line A549 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GLIS3 Antibody [NBP2-33787] - Staining of human thyroid gland shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GLIS3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SPGHNVQGSPHNPSSQLPPLTAVDAGAERFAPSAPSPHHISPRRVPAPSSILQRTQPPYTQQPSGSHLKSYQPETNSSFQPNGI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLIS3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GLIS3 Protein (NBP2-33787PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GLIS3 Antibody - BSA Free

• FLJ38999
• FLJ90578
• GLIS family zinc finger 3
• GLI-similar 3
• OK/KNS-cl.4
• zinc finger protein 515
• zinc finger protein GLIS3

Background

The GLIS3 gene is a member of the GLI-similar zinc finger protein family and encodes a nuclear protein with five C2H2-typezinc finger domains. This protein functions as both a repressor and activator of transcription and is specificallyinvolved in the developm

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GLIS3 Antibody (NBP2-33787)(1)

Publication using NBP2-33787

• Nikiforova MN, Nikitski AV, Panebianco F et al. GLIS Rearrangement is a Genomic Hallmark of Hyalinizing Trabecular Tumor of the Thyroid Gland. Thyroid 2019-01-16 [PMID: 30648929] (IHC-P, Human)

Bioinformatics

• Gene Symbol: GLIS3
• Uniprot:
  • Q8NEA6(Human)