Glis1 Antibody - BSA Free

Western Blot: Glis1 Antibody [NBP3-10440] - Western blot analysis of Glis1 in Mouse Kidney as a positive control. Antibody dilution at 0.2-1 ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Glis1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Glis1 Antibody - BSA Free (NBP3-10440) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_671754). Peptide sequence DKRPKEAPGAPGQGRGPVSLGAHMAFRIAVSGGGCGDGNPLDLLPRLPVP
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLIS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 84 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Glis1 Antibody - BSA Free

• FLJ36155
• GLIS family zinc finger 1
• Glis1
• GLI-similar 1
• zinc finger protein GLIS1

Background

GLIS1 is a GLI (MIM 165220)-related Kruppel-like zinc finger protein that functions as an activator and repressor oftranscription (Kim et al., 2002 (PubMed 12042312)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLIS1