ZNF300 Antibody


Western Blot: ZNF300 Antibody [NBP2-13566] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: ZNF300 Antibody [NBP2-13566] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ZNF300 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILK GVTRDGSLCS
Specificity of human ZNF300 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF300 Protein (NBP2-13566PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF300 Antibody

  • kruppel-like zinc finger protein
  • zinc finger protein 300


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZNF300 Antibody (NBP2-13566) (0)

There are no publications for ZNF300 Antibody (NBP2-13566).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF300 Antibody (NBP2-13566) (0)

There are no reviews for ZNF300 Antibody (NBP2-13566). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF300 Antibody (NBP2-13566) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF300 Products

Bioinformatics Tool for ZNF300 Antibody (NBP2-13566)

Discover related pathways, diseases and genes to ZNF300 Antibody (NBP2-13566). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF300 Antibody (NBP2-13566)

Discover more about diseases related to ZNF300 Antibody (NBP2-13566).

Pathways for ZNF300 Antibody (NBP2-13566)

View related products by pathway.

PTMs for ZNF300 Antibody (NBP2-13566)

Learn more about PTMs related to ZNF300 Antibody (NBP2-13566).

Blogs on ZNF300

There are no specific blogs for ZNF300, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF300 Antibody and receive a gift card or discount.


Gene Symbol ZNF300