GLI-1 Antibody


Immunocytochemistry/ Immunofluorescence: GLI-1 Antibody [NBP2-56230] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF

Order Details

GLI-1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS
Specificity of human GLI-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLI-1 Recombinant Protein Antigen (NBP2-56230PEP)

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for GLI-1 Antibody

  • GLI family zinc finger 1
  • GLI1
  • GLI-1
  • glioma-associated oncogene family zinc finger 1
  • glioma-associated oncogene homolog 1 (zinc finger protein)
  • Glioma-associated oncogene
  • GLIzinc finger protein GLI1
  • Oncogene GLI


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ChIP, ICC
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Species: Hu, Rt
Applications: ICC/IF

Publications for GLI-1 Antibody (NBP2-56230) (0)

There are no publications for GLI-1 Antibody (NBP2-56230).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-1 Antibody (NBP2-56230) (0)

There are no reviews for GLI-1 Antibody (NBP2-56230). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GLI-1 Antibody (NBP2-56230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional GLI-1 Products

Bioinformatics Tool for GLI-1 Antibody (NBP2-56230)

Discover related pathways, diseases and genes to GLI-1 Antibody (NBP2-56230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI-1 Antibody (NBP2-56230)

Discover more about diseases related to GLI-1 Antibody (NBP2-56230).

Pathways for GLI-1 Antibody (NBP2-56230)

View related products by pathway.

PTMs for GLI-1 Antibody (NBP2-56230)

Learn more about PTMs related to GLI-1 Antibody (NBP2-56230).

Research Areas for GLI-1 Antibody (NBP2-56230)

Find related products by research area.

Blogs on GLI-1

There are no specific blogs for GLI-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GLI-1 Antibody and receive a gift card or discount.


Gene Symbol GLI1