GLI-1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GLI-1 Antibody [NBP2-56230] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GLI-1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLI1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GLI-1 Recombinant Protein Antigen (NBP2-56230PEP)

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GLI-1 Antibody - BSA Free

• GLI family zinc finger 1
• GLI1
• GLI-1
• glioma-associated oncogene family zinc finger 1
• glioma-associated oncogene homolog 1 (zinc finger protein)
• Glioma-associated oncogene
• GLIzinc finger protein GLI1
• Oncogene GLI

Background

Gli1 was produced against a peptide corresponding to the carboxy-terminal region of the mouse Gli-1 protein. This region is not conserved among other gli family members, namely Gli-2 and Gli-3. Gli was termed by Kinzler et al. (1987) as 'glioma-associated oncogene' amplified in malignant gliomas. Analysis of the cloned gene demonstrates that the gene contains 5 repeats of zinc-finger sequences, which places gli in the family of Kruppel (Kr) zinc finger proteins. Northern analysis reveals that GLI is expressed in embryonal carcinoma cells but not in most adult tissue. GLI has been localized to 12q13-q14.3 by Southern blot analysis. On mouse the gene is located on chromosome 10. In mice, 3 zinc finger transcription factors, Gli-1, Gl-i2 and Gli-3, have been implicated in the transduction of Sonic hedgehog (Shh) signal. In papillary epithelium, shh, gli1 and ptc all follow similar expression patterns. Gli1 expression is central and probably sufficient for tumor development in humans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLI1