Home » GLI-1 » GLI-1 Antibodies » GLI-1 Antibody

GLI-1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: GLI-1 Antibody [NBP2-56230] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunocytochemistry/ Immunofluorescence: GLI-1 Antibody [NBP2-56230] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GLI-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS
Specificity
Specificity of human GLI-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLI1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLI-1 Recombinant Protein Antigen (NBP2-56230PEP)

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GLI-1 Antibody

  • GLI family zinc finger 1
  • GLI1
  • GLI-1
  • glioma-associated oncogene family zinc finger 1
  • glioma-associated oncogene homolog 1 (zinc finger protein)
  • Glioma-associated oncogene
  • GLIzinc finger protein GLI1
  • Oncogene GLI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sonic Hedgehog/Shh
[Unconjugated]
1845-SH
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog # 1845-SH) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
(5 Reviews)
(36 Publications)
Species: Hu
Recombinant Human
Blood group H inhibit ...
H00002523-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
HFE Antibody (1G12)
H00003077-M01
Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Patched 1/PTCH
Antibody
NBP1-71662
Western Blot: Patched 1/PTCH Antibody [NBP1-71662] - Analysis of Patched 1 in human skeletal muscle protein.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
GLI-2 Antibody
AF3635
GLI‑2 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Mouse GLI‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3635) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling when primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Reviews)
(14 Publications)
Species: Mu
Applications: WB, IHC
Smoothened Antibody
NLS2666
Immunohistochemistry-Paraffin: Smoothened Antibody [NLS2666] - Analysis of anti-Smoothened antibody with human kidney.
(1 Publication)
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
SMOX Antibody
NBP2-55775
Western Blot: SMOX Antibody [NBP2-55775] - Analysis in human cell line A-549 and human cell line MCF-7
Immunocytochemistry/Immunofluorescence: SMOX Antibody [NBP2-55775] - Staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & vesicles. Antibody staining is shown in green.
Species: Hu
Applications: WB, ICC/IF
GLI-3 Antibody
AF3690
Western blot shows lysates of mouse embryo tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse GLI‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3690) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for GLI‑3 at approximately 85 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL PMA and 200 ng/mL calcium ionomycin for 30 minutes was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. GLI‑3/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse GLI‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3690) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The gli-1 promoter was detected by standard PCR.
GLI‑3 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Human/Mouse GLI‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3690) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Reviews)
(35 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ICC
Smoothened Antibody
NLS2666
Immunohistochemistry-Paraffin: Smoothened Antibody [NLS2666] - Analysis of anti-Smoothened antibody with human kidney.
(1 Publication)
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
Indian
Hedgehog/Ihh [Unconju
1705-HH/CF
Indian Hedgehog/Ihh [Unconjugated]
(6 Publications)
Species: Hu, Mu
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Glucagon was detected in immersion fixed beta TC-6 mouse beta cell insulinoma cell line using 10 µg/mL Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
beta TC‑6 mouse beta cell insulinoma cell line was stained with Mouse Anti-Human/Mouse Glucagon Monoclonal Antibody (Catalog # MAB1249, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
(3 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Suppressor of
Fused Antibody
NBP2-20536
Western Blot: Suppressor of Fused Antibody [NBP2-20536] - Sample (30 ug of whole cell lysate) A: Hela 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Suppressor of Fused Antibody [NBP2-20536] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Suppressor of Fused Antibody [NBP2-20536] - Suppressor of Fused antibody detects Suppressor of Fused protein at cytosol and nucleus on mouse testis by immunohistochemical analysis. Sample: Paraffin-embedded mouse testis. Suppressor of Fused antibody dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NDUFB6 Antibody
NBP1-92172
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Human Factor IX
ELISA Kit (Colorimetr ...
NBP2-60518
ELISA: Human Factor IX ELISA Kit (Colorimetric) [NBP2-60518] - Standard curve.
ELISA: Human Factor IX ELISA Kit (Colorimetric) [NBP2-60518] - Standard curve.
Species: Hu
Ret Antibody
[Unconjugated]
AF482
Ret was detected in perfusion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Ret Antigen Affinity-purified Polyclonal Antibody (Catalog # AF482) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the ventral horn. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(26 Publications)
Species: Mu
Applications: WB, IHC
TAS2R38 Antibody
NBP2-80532
TAS2R38 Antibody
Species: Hu, Pm
Applications: WB, IHC, IHC-P
CCDC6 Antibody
NBP1-85351
Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: CCDC6 Antibody [NBP1-85351] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(4 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
GLI-1 Antibody
NBP2-56230
GLI-1 Antibody
Species: Hu, Rt
Applications: ICC/IF

Publications for GLI-1 Antibody (NBP2-56230) (0)

There are no publications for GLI-1 Antibody (NBP2-56230).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-1 Antibody (NBP2-56230) (0)

There are no reviews for GLI-1 Antibody (NBP2-56230). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GLI-1 Antibody (NBP2-56230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional GLI-1 Products

Bioinformatics Tool for GLI-1 Antibody (NBP2-56230)

Discover related pathways, diseases and genes to GLI-1 Antibody (NBP2-56230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI-1 Antibody (NBP2-56230)

Discover more about diseases related to GLI-1 Antibody (NBP2-56230).
 

Pathways for GLI-1 Antibody (NBP2-56230)

View related products by pathway.

PTMs for GLI-1 Antibody (NBP2-56230)

Learn more about PTMs related to GLI-1 Antibody (NBP2-56230).
 

Research Areas for GLI-1 Antibody (NBP2-56230)

Find related products by research area.

Blogs on GLI-1

There are no specific blogs for GLI-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLI-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GLI1