GK5 Antibody - BSA Free

Immunohistochemistry-Paraffin: GK5 Antibody [NBP1-82692] - Staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GK5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GK5 Antibody - BSA Free (NBP1-82692) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIFGVPIPIVAL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GK5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GK5 Protein (NBP1-82692PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GK5 Antibody - BSA Free

• ATP:glycerol 3-phosphotransferase 5
• EC 2.7.1.30
• FLJ33582
• FLJ45739
• GK 5
• Glycerokinase 5
• glycerol kinase 5 (putative)
• MGC40579
• putative glycerol kinase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GK5