GK5 Antibody

Images

 
Immunohistochemistry-Paraffin: GK5 Antibody [NBP1-82692] - Staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GK5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISIPLSLLPPVRDTSHNFGSVDEEIFGVPIPIVAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GK5 Protein (NBP1-82692PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GK5 Antibody

  • ATP:glycerol 3-phosphotransferase 5
  • EC 2.7.1.30
  • FLJ33582
  • FLJ45739
  • GK 5
  • Glycerokinase 5
  • glycerol kinase 5 (putative)
  • MGC40579
  • putative glycerol kinase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57033
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27101
Species: Hu, Pm
Applications: WB
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
MAB8526
Species: Mu
Applications: IHC
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-57453
Species: Hu
Applications: ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-56149
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-82692
Species: Hu
Applications: IHC, IHC-P

Publications for GK5 Antibody (NBP1-82692) (0)

There are no publications for GK5 Antibody (NBP1-82692).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GK5 Antibody (NBP1-82692) (0)

There are no reviews for GK5 Antibody (NBP1-82692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GK5 Antibody (NBP1-82692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GK5 Products

Bioinformatics Tool for GK5 Antibody (NBP1-82692)

Discover related pathways, diseases and genes to GK5 Antibody (NBP1-82692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GK5 Antibody (NBP1-82692)

Discover more about diseases related to GK5 Antibody (NBP1-82692).
 

Pathways for GK5 Antibody (NBP1-82692)

View related products by pathway.

PTMs for GK5 Antibody (NBP1-82692)

Learn more about PTMs related to GK5 Antibody (NBP1-82692).
 

Research Areas for GK5 Antibody (NBP1-82692)

Find related products by research area.

Blogs on GK5

There are no specific blogs for GK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GK5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GK5