GIT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GIT1 Antibody [NBP1-86144] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & focal adhesion sites.
Immunohistochemistry-Paraffin: GIT1 Antibody [NBP1-86144] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GIT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVSSSLSDELRRLQREIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GIT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GIT1 Protein (NBP1-86144PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GIT1 Antibody

  • ARF GAP GIT1
  • ARF GTPase-activating protein GIT1
  • CAT1
  • CAT-1
  • Cool-associated and tyrosine-phosphorylated protein 1
  • G protein-coupled receptor kinase interacting ArfGAP 1
  • G protein-coupled receptor kinase interactor 1
  • G protein-coupled receptor kinase-interactor 1
  • GIT1
  • GRK-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00009815-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP2-58924
Species: Hu
Applications: ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
MAB2688
Species: Hu
Applications: WB
NBP1-86144
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for GIT1 Antibody (NBP1-86144) (0)

There are no publications for GIT1 Antibody (NBP1-86144).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIT1 Antibody (NBP1-86144) (0)

There are no reviews for GIT1 Antibody (NBP1-86144). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GIT1 Antibody (NBP1-86144) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GIT1 Products

Bioinformatics Tool for GIT1 Antibody (NBP1-86144)

Discover related pathways, diseases and genes to GIT1 Antibody (NBP1-86144). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIT1 Antibody (NBP1-86144)

Discover more about diseases related to GIT1 Antibody (NBP1-86144).
 

Pathways for GIT1 Antibody (NBP1-86144)

View related products by pathway.

PTMs for GIT1 Antibody (NBP1-86144)

Learn more about PTMs related to GIT1 Antibody (NBP1-86144).

Blogs on GIT1

There are no specific blogs for GIT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GIT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GIT1
Entrez