GGN Antibody

Images

 
Western Blot: GGN Antibody [NBP1-53063] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GGN Antibody Summary

Immunogen
Synthetic peptides corresponding to GGN(gametogenetin) The peptide sequence was selected from the N terminal of GGN. Peptide sequence GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GGN and was validated on Western blot.
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GGN Antibody

  • FLJ35713
  • gametogenetin
  • MGC33369

Background

GGN may be involved in spermatogenesis.This gene is a germ cell-specific gene that encodes proteins that interact with POG (proliferation of germ cells). Alternatively spliced transcript variants of a similar mouse gene encode at least three different proteins, namely gametogenetin protein 1a, gametogenetin protein 2, and gametogenetin protein 3, which show a perinuclear, cytoplasmic, and nucleolar localization, respectively. These proteins regulate the localization of POG and may play a role in spermatogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84758
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005813-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-56186
Species: Hu
Applications: ICC/IF
NBP1-85452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53063
Species: Hu
Applications: WB

Publications for GGN Antibody (NBP1-53063) (0)

There are no publications for GGN Antibody (NBP1-53063).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGN Antibody (NBP1-53063) (0)

There are no reviews for GGN Antibody (NBP1-53063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GGN Antibody (NBP1-53063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GGN Products

Bioinformatics Tool for GGN Antibody (NBP1-53063)

Discover related pathways, diseases and genes to GGN Antibody (NBP1-53063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGN Antibody (NBP1-53063)

Discover more about diseases related to GGN Antibody (NBP1-53063).
 

Pathways for GGN Antibody (NBP1-53063)

View related products by pathway.

PTMs for GGN Antibody (NBP1-53063)

Learn more about PTMs related to GGN Antibody (NBP1-53063).

Blogs on GGN

There are no specific blogs for GGN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GGN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GGN
Uniprot