GGA3 Antibody


Western Blot: GGA3 Antibody [NBP2-55191] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: GGA3 Antibody [NBP2-55191] - Staining of human cell line RH-30 shows localization to the Golgi apparatus.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

GGA3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDK
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GGA3 Recombinant Protein Antigen (NBP2-55191PEP)

Reactivity Notes

Rat 82%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for GGA3 Antibody

  • ADP-ribosylation factor-binding protein GGA3
  • golgi associated, gamma adaptin ear containing, ARF binding protein 3
  • golgi-associated, gamma adaptin ear containing, ARF binding protein 3
  • KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: WB, ICC/IF

Publications for GGA3 Antibody (NBP2-55191) (0)

There are no publications for GGA3 Antibody (NBP2-55191).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGA3 Antibody (NBP2-55191) (0)

There are no reviews for GGA3 Antibody (NBP2-55191). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GGA3 Antibody (NBP2-55191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GGA3 Products

Bioinformatics Tool for GGA3 Antibody (NBP2-55191)

Discover related pathways, diseases and genes to GGA3 Antibody (NBP2-55191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGA3 Antibody (NBP2-55191)

Discover more about diseases related to GGA3 Antibody (NBP2-55191).

Pathways for GGA3 Antibody (NBP2-55191)

View related products by pathway.

PTMs for GGA3 Antibody (NBP2-55191)

Learn more about PTMs related to GGA3 Antibody (NBP2-55191).

Research Areas for GGA3 Antibody (NBP2-55191)

Find related products by research area.

Blogs on GGA3

There are no specific blogs for GGA3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GGA3 Antibody and receive a gift card or discount.


Gene Symbol GGA3