GGA3 Antibody - BSA Free

Western Blot: GGA3 Antibody [NBP2-55191] - Analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: GGA3 Antibody [NBP2-55191] - Staining of human cell line RH-30 shows localization to the Golgi apparatus.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GGA3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GGA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GGA3 Recombinant Protein Antigen (NBP2-55191PEP)

Reactivity Notes

Rat 82%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GGA3 Antibody - BSA Free

• ADP-ribosylation factor-binding protein GGA3
• golgi associated, gamma adaptin ear containing, ARF binding protein 3
• golgi-associated, gamma adaptin ear containing, ARF binding protein 3
• KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3

Background

GGA3 encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network (TGN) and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma- adaptins. GGA3 mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (AC-LL) motif. Alternative splicing of this gene results in two transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GGA3