GFR alpha-3/GDNF R alpha-3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GFRA3. Source: E. coli
Amino Acid Sequence: LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GFRA3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89774. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GFR alpha-3/GDNF R alpha-3 Recombinant Protein Antigen
Background
Members of the glial cell line-derived neurotrophic factor (GDNF) family, including GDNF and neurturin (NTN), play key roles in the control of vertebrate neuronal survival and differentiation. A new member of the GDNF family was recently identified and designated persephin. Physiological responses to these neurotrophic factors require two receptor subunits, the novel glycosylphosphatidylinositol linked protein GFRalpha and Ret receptor tyrosine kinase GFRbeta. Following the identification of GFRalpha-1 and 2, another receptor in the GFR family was identified in human and mouse and designated GFRalpha-3. GFRalpha-3 binds persephin. Thus, persephin, GFRalpha-3, and Ret PTK form a complex to transmit the persephin signal and to mediate persephin function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind, BA
Species: Mu
Applications: IHC, Neut, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: Bind, BA
Species: Rt
Applications: Block, IHC, WB
Species: Hu, Mu
Applications: Block, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Neut, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: IHC, WB
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: AC
Publications for GFR alpha-3/GDNF R alpha-3 Protein (NBP1-89774PEP) (0)
There are no publications for GFR alpha-3/GDNF R alpha-3 Protein (NBP1-89774PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GFR alpha-3/GDNF R alpha-3 Protein (NBP1-89774PEP) (0)
There are no reviews for GFR alpha-3/GDNF R alpha-3 Protein (NBP1-89774PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GFR alpha-3/GDNF R alpha-3 Protein (NBP1-89774PEP) (0)
Additional GFR alpha-3/GDNF R alpha-3 Products
Research Areas for GFR alpha-3/GDNF R alpha-3 Protein (NBP1-89774PEP)
Find related products by research area.
|
Blogs on GFR alpha-3/GDNF R alpha-3