GERP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GERP Antibody [NBP1-89776] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: GERP Antibody [NBP1-89776] - Staining of human skeletal muscle shows cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GERP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLHQLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GERP Protein (NBP1-89776PEP)
Publications
Read Publication using NBP1-89776.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GERP Antibody

  • EC 6.3.2.-
  • GERPRING finger protein 27glioblastoma expressed ring finger protein
  • Glioblastoma-expressed RING finger protein
  • RNF27probable E3 ubiquitin-protein ligase TRIM8
  • tripartite motif containing 8
  • tripartite motif protein TRIM8
  • tripartite motif-containing 8
  • Tripartite motif-containing protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56637
Species: Hu, Mu
Applications: WB
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
AF523
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready, Neut
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-77160
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for GERP Antibody (NBP1-89776)(1)


Reviews for GERP Antibody (NBP1-89776) (0)

There are no reviews for GERP Antibody (NBP1-89776). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GERP Antibody (NBP1-89776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GERP Products

Bioinformatics Tool for GERP Antibody (NBP1-89776)

Discover related pathways, diseases and genes to GERP Antibody (NBP1-89776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GERP Antibody (NBP1-89776)

Discover more about diseases related to GERP Antibody (NBP1-89776).
 

Pathways for GERP Antibody (NBP1-89776)

View related products by pathway.

PTMs for GERP Antibody (NBP1-89776)

Learn more about PTMs related to GERP Antibody (NBP1-89776).
 

Research Areas for GERP Antibody (NBP1-89776)

Find related products by research area.

Blogs on GERP

There are no specific blogs for GERP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GERP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM8
Entrez
Uniprot