GEMIN6 Antibody


Western Blot: GEMIN6 Antibody [NBP1-82075] - Analysis in control (vector only transfected HEK293T lysate) and GEMIN6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry-Paraffin: GEMIN6 Antibody [NBP1-82075] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in cortical cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GEMIN6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSS
Specificity of human GEMIN6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
GEMIN6 Lysate (NBP2-65130)
Control Peptide
GEMIN6 Protein (NBP1-82075PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GEMIN6 Antibody

  • FLJ23459
  • gem (nuclear organelle) associated protein 6
  • gem-associated protein 6
  • gemin 6
  • gemin-6
  • SIP2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Po, SyHa
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GEMIN6 Antibody (NBP1-82075) (0)

There are no publications for GEMIN6 Antibody (NBP1-82075).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEMIN6 Antibody (NBP1-82075) (0)

There are no reviews for GEMIN6 Antibody (NBP1-82075). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GEMIN6 Antibody (NBP1-82075) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GEMIN6 Antibody (NBP1-82075)

Discover related pathways, diseases and genes to GEMIN6 Antibody (NBP1-82075). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GEMIN6 Antibody (NBP1-82075)

Discover more about diseases related to GEMIN6 Antibody (NBP1-82075).

Pathways for GEMIN6 Antibody (NBP1-82075)

View related products by pathway.

PTMs for GEMIN6 Antibody (NBP1-82075)

Learn more about PTMs related to GEMIN6 Antibody (NBP1-82075).

Research Areas for GEMIN6 Antibody (NBP1-82075)

Find related products by research area.

Blogs on GEMIN6

There are no specific blogs for GEMIN6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GEMIN6 Antibody and receive a gift card or discount.


Gene Symbol GEMIN6