New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

GEMIN6 Antibody

Images

 
Western Blot: GEMIN6 Antibody [H00079833-D01P] - Analysis of GEMIN6 expression in human stomach.
Western Blot: GEMIN6 Antibody [H00079833-D01P] - Analysis of GEMIN6 expression in transfected 293T cell line by GEMIN6 polyclonal antibody.Lane 1: GEMIN6 transfected lysate(18.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GEMIN6 Antibody Summary

Immunogen
GEMIN6 (AAH18195.1, 1 a.a. - 167 a.a.) full-length human protein. MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYDPENCSSSNEIILSRVQDLIEGHLTASQ
Specificity
GEMIN6 - gem (nuclear organelle) associated protein 6,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GEMIN6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GEMIN6 Antibody

  • FLJ23459
  • gem (nuclear organelle) associated protein 6
  • gem-associated protein 6
  • gemin 6
  • gemin-6
  • SIP2

Background

GEMIN6 is part of a large macromolecular complex, localized to both the cytoplasm and the nucleus, that plays a role in the cytoplasmic assembly of small nuclear ribonucleoproteins (snRNPs). Other members of this complex include SMN (MIM 600354), GEMIN2 (SIP1; MIM 602595), GEMIN3 (DDX20; MIM 606168), GEMIN4 (MIM 606969), and GEMIN5 (MIM 607005).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-82991
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NB100-2450
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-55266
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-20439
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
H00079760-D01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-52454
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB
NBP2-24740
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IHC, IHC-P, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00005564-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB100-61049
Species: Ba, SyHa, Hu, Po
Applications: IP, WB
NB110-40591
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-20881
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33923
Species: Hu
Applications: ICC/IF, WB
H00079833-D01P
Species: Hu
Applications: WB

Publications for GEMIN6 Antibody (H00079833-D01P) (0)

There are no publications for GEMIN6 Antibody (H00079833-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEMIN6 Antibody (H00079833-D01P) (0)

There are no reviews for GEMIN6 Antibody (H00079833-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GEMIN6 Antibody (H00079833-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GEMIN6 Products

Bioinformatics Tool for GEMIN6 Antibody (H00079833-D01P)

Discover related pathways, diseases and genes to GEMIN6 Antibody (H00079833-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GEMIN6 Antibody (H00079833-D01P)

Discover more about diseases related to GEMIN6 Antibody (H00079833-D01P).
 

Pathways for GEMIN6 Antibody (H00079833-D01P)

View related products by pathway.

PTMs for GEMIN6 Antibody (H00079833-D01P)

Learn more about PTMs related to GEMIN6 Antibody (H00079833-D01P).
 

Research Areas for GEMIN6 Antibody (H00079833-D01P)

Find related products by research area.

Blogs on GEMIN6

There are no specific blogs for GEMIN6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GEMIN6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GEMIN6
Entrez
Uniprot