GEMIN2 Antibody

Western Blot: SIP1 Antibody [H00008487-B01P] - Analysis of SIP1 expression in HeLa.

Immunocytochemistry/Immunofluorescence: SIP1 Antibody [H00008487-B01P] - Analysis of purified antibody to SIP1 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: SIP1 Antibody [H00008487-B01P] - Analysis of SIP1 expression in transfected 293T cell line by SIP1 polyclonal antibody. Lane 1: SIP1 transfected lysate(30.8 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

GEMIN2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SIP1 (NP_003607.1, 1 a.a. - 280 a.a.) full-length human protein. MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
• Specificity: SIP1 - survival of motor neuron protein interacting protein 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GEMIN2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GEMIN2 Antibody

• Component of gems 2
• Gemin-2
• GEMIN2survival of motor neuron protein-interacting protein 1
• SIP1-delta
• SMN interacting protein 1-delta
• SMN-interacting protein 1
• survival of motor neuron protein interacting protein 1

Background

This gene encodes one of the proteins found in the SMN complex, which consists of the suvival of motor neuron protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. This protein interacts directly with the survival of motor neuron protein and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GEMIN2
• Entrez:
  • 8487(Human)
• Uniprot:
  • NP_003607.1(Human)