GEMIN2 Antibody

Images

 
Western Blot: SIP1 Antibody [H00008487-B01P] - Analysis of SIP1 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: SIP1 Antibody [H00008487-B01P] - Analysis of purified antibody to SIP1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: SIP1 Antibody [H00008487-B01P] - Analysis of SIP1 expression in transfected 293T cell line by SIP1 polyclonal antibody. Lane 1: SIP1 transfected lysate(30.8 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GEMIN2 Antibody Summary

Immunogen
SIP1 (NP_003607.1, 1 a.a. - 280 a.a.) full-length human protein. MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Specificity
SIP1 - survival of motor neuron protein interacting protein 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GEMIN2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GEMIN2 Antibody

  • Component of gems 2
  • Gemin-2
  • GEMIN2survival of motor neuron protein-interacting protein 1
  • SIP1-delta
  • SMN interacting protein 1-delta
  • SMN-interacting protein 1
  • survival of motor neuron protein interacting protein 1

Background

This gene encodes one of the proteins found in the SMN complex, which consists of the suvival of motor neuron protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. This protein interacts directly with the survival of motor neuron protein and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-52453
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82075
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-61049
Species: Hu, Po, SyHa
Applications: WB, IP
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBL1-08305
Species: Hu

Publications for GEMIN2 Antibody (H00008487-B01P) (0)

There are no publications for GEMIN2 Antibody (H00008487-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEMIN2 Antibody (H00008487-B01P) (0)

There are no reviews for GEMIN2 Antibody (H00008487-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GEMIN2 Antibody (H00008487-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GEMIN2 Products

Bioinformatics Tool for GEMIN2 Antibody (H00008487-B01P)

Discover related pathways, diseases and genes to GEMIN2 Antibody (H00008487-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GEMIN2 Antibody (H00008487-B01P)

Discover more about diseases related to GEMIN2 Antibody (H00008487-B01P).
 

Pathways for GEMIN2 Antibody (H00008487-B01P)

View related products by pathway.

PTMs for GEMIN2 Antibody (H00008487-B01P)

Learn more about PTMs related to GEMIN2 Antibody (H00008487-B01P).
 

Research Areas for GEMIN2 Antibody (H00008487-B01P)

Find related products by research area.

Blogs on GEMIN2

There are no specific blogs for GEMIN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GEMIN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GEMIN2
Entrez
Uniprot