GEM Antibody - BSA Free

Western Blot: GEM Antibody [NBP1-81350] - Analysis in control (vector only transfected HEK293T lysate) and GEM over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: GEM Antibody [NBP1-81350] - Staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GEM Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GEM Antibody - BSA Free (NBP1-81350) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GEM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GEM Protein (NBP1-81350PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GEM Antibody - BSA Free

• GTP binding protein overexpressed in skeletal muscle
• GTP-binding mitogen-induced T-cell protein
• GTP-binding protein GEM
• GTP-binding protein overexpressed in skeletal muscle
• kinase-inducible Ras-like protein
• KIRMGC26294
• RAS-like protein KIR

Background

The protein encoded by the GEM gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the innerface of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GEM