GEM Antibody - BSA Free

Western Blot: GEM Antibody [NBP1-58906] - Human Stomach Tumor cell lysate. Antibody at 1.0 ug/mL.

Immunohistochemistry: GEM Antibody [NBP1-58906] - Human kidney tissue section. Magnification: 400X.

Western Blot: GEM Antibody [NBP1-58906] - HepG2 cell lysate. Antibody at 2.5 ug/mL.

Immunohistochemistry-Paraffin: GEM Antibody [NBP1-58906] - Human Skin Cellular Data: Squamous epithelial tissue section. Magnification: 400X.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

GEM Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GEM(GTP binding protein overexpressed in skeletal muscle) The peptide sequence was selected from the C terminal of GEM (NP_005252). Peptide sequence ETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFW The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GEM
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 4 - 8 ug/mL
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunocytochemistry/immunofluorescence and Immunohistochemistry-Frozen reported in scientific literature (PMID 24809506).
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24809506).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for GEM Antibody - BSA Free

• GTP binding protein overexpressed in skeletal muscle
• GTP-binding mitogen-induced T-cell protein
• GTP-binding protein GEM
• GTP-binding protein overexpressed in skeletal muscle
• kinase-inducible Ras-like protein
• KIRMGC26294
• RAS-like protein KIR

Background

GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GEM Antibody (NBP1-58906)(2)

Publications using NBP1-58906

• Laurberg Jens Reumert, Jensen Jorgen Bjerggaard, Schepeler Troels et al. High expression of GEM and EDNRA is associated with metastasis and poor outcome in patients with advanced bladder cancer. BMC Cancer. 2014-08-30 [PMID: 25175477] (WB)
• Scamps F, Sangari S, Bowerman M et al. Nerve injury induces a Gem-GTPase-dependent downregulation of P/Q-type Ca(2+) channels contributing to neurite plasticity in dorsal root ganglion neurons. Pflugers Arch. 2014-05-09 [PMID: 24809506] (ICC/IF, IHC-Fr, WB, Mouse)

Review for GEM Antibody (NBP1-58906) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Valeria Di Leo IHC-Fr Human 11/05/2020

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Skeletal muscle tissue,Skeletal muscle
• Species: Human
• Lot: NBP1-58906

Comments

• Comments: Fixative: 4% paraformaldehyde
  Permeabilization: Methanol gradient (70% for 10 mins, 95% for 10 mins, 100% for 20 mins, 95% for 10 mins, 70% for 10 mins)
  Protein blocking: 10% NGS diluted in TBST
  Endogenous biotin blocking: Avidin D solution for 15 mins, Biotin for 15 mins (Vector Laboratories, Inc)
  Dilution: 1/50
  Incubation time: 19 hour(s) and 0 minute(s) · Diluent TBST – NGS 10%
  Secondary antibody: Life tech/ThermoFisher, A11006, Alexa 488, anti-Rabbit isotype IgG, Host species: Goat, Clonality: Polyclonal

Bioinformatics

• Gene Symbol: GEM
• Entrez:
  • 2669(Human)
• Uniprot:
  • P55040(Human)