GDF-5/BMP-14 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GDF-5/BMP-14 Antibody - BSA Free (NBP1-88575) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RYVFDISALEKDGLLGAELRILRKKPSDTAKPAAPGGGRAAQLKLSSCPSGRQPASLLDVRSVPGLDGSGWEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GDF5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GDF-5/BMP-14 Antibody - BSA Free
Background
The GDF5 gene is involved in skeletal development through bone and cartilage formation. This gene encodes for a 501 amino acid long, 55 kDA protein that is part of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily which is known to regulate cell growth and differentiation in embryotic and adult tissues. The GDF5 gene is involved in paxillian interactions, mitochondrial apoptosis, the cytokine-cytokine receptor interaction, and the TGF-beta signaling pathway through interacting with other genes such as BMPR1A, BMPR1B, BMPR2, HTRA1, and CHRDL2. The GDF5 gene has been associated to chondrodysplasia, synostosis, periostitis, short stature, cushing's symphalangism, brachydactyly and ankylosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: BA
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for GDF-5/BMP-14 Antibody (NBP1-88575) (0)
There are no publications for GDF-5/BMP-14 Antibody (NBP1-88575).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GDF-5/BMP-14 Antibody (NBP1-88575) (0)
There are no reviews for GDF-5/BMP-14 Antibody (NBP1-88575).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GDF-5/BMP-14 Antibody (NBP1-88575) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GDF-5/BMP-14 Products
Research Areas for GDF-5/BMP-14 Antibody (NBP1-88575)
Find related products by research area.
|
Blogs on GDF-5/BMP-14