GDF-3 Antibody


Western Blot: GDF-3 Antibody [NBP1-86443] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with a more
Immunohistochemistry-Paraffin: GDF-3 Antibody [NBP1-86443] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GDF-3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVV
Embryonic Stem Cell Marker
Specificity of human GDF-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GDF-3 Protein (NBP1-86443PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GDF-3 Antibody

  • GDF3
  • GDF-3
  • growth differentiation factor 3
  • growth/differentiation factor 3
  • KFS3
  • MCOP7
  • Vgr-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB
Species: Rt
Applications: WB, Flow, CyTOF-ready
Species: Mu, Ha
Applications: WB, IHC
Species: Hu
Applications: WB, Block
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Mu
Applications: IHC
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
Species: Hu
Applications: IHC-P

Publications for GDF-3 Antibody (NBP1-86443) (0)

There are no publications for GDF-3 Antibody (NBP1-86443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-3 Antibody (NBP1-86443) (0)

There are no reviews for GDF-3 Antibody (NBP1-86443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDF-3 Antibody (NBP1-86443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GDF-3 Products

Bioinformatics Tool for GDF-3 Antibody (NBP1-86443)

Discover related pathways, diseases and genes to GDF-3 Antibody (NBP1-86443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-3 Antibody (NBP1-86443)

Discover more about diseases related to GDF-3 Antibody (NBP1-86443).

Pathways for GDF-3 Antibody (NBP1-86443)

View related products by pathway.

PTMs for GDF-3 Antibody (NBP1-86443)

Learn more about PTMs related to GDF-3 Antibody (NBP1-86443).

Research Areas for GDF-3 Antibody (NBP1-86443)

Find related products by research area.

Blogs on GDF-3

There are no specific blogs for GDF-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GDF-3 Antibody and receive a gift card or discount.


Gene Symbol GDF3