GDC Antibody (1H7) - Azide and BSA Free

Western Blot: GDC Antibody (1H7) [H00008034-M01] - SLC25A16 monoclonal antibody (M01), clone 1H7. Analysis of SLC25A16 expression in HeLa.

Sandwich ELISA: GDC Antibody (1H7) [H00008034-M01] - Detection limit for recombinant GST tagged SLC25A16 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1H7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GDC Antibody (1H7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SLC25A16 (NP_689920.1, 59 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR
• Specificity: Reacts with solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC25A16
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate for WB and recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GDC Antibody (1H7) - Azide and BSA Free

• D10S105EGDC
• GDASolute carrier family 25 member 16
• Graves disease autoantigen
• graves disease carrier protein
• HGT.1
• hML7
• member 16
• MGC39851
• Mitochondrial solute carrier protein homolog
• ML7
• solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen)

Background

This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC25A16
• Entrez:
  • 8034(Human)
• Uniprot:
  • NP_689920(Human)