GDC Antibody (1H7)

Images

 
Western Blot: GDC Antibody (1H7) [H00008034-M01] - SLC25A16 monoclonal antibody (M01), clone 1H7. Analysis of SLC25A16 expression in HeLa.
Sandwich ELISA: GDC Antibody (1H7) [H00008034-M01] - Detection limit for recombinant GST tagged SLC25A16 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GDC Antibody (1H7) Summary

Immunogen
SLC25A16 (NP_689920.1, 59 a.a. - 133 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHR
Specificity
Reacts with solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC25A16
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate for WB and recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GDC Antibody (1H7)

  • D10S105EGDC
  • GDASolute carrier family 25 member 16
  • Graves disease autoantigen
  • graves disease carrier protein
  • HGT.1
  • hML7
  • member 16
  • MGC39851
  • Mitochondrial solute carrier protein homolog
  • ML7
  • solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen)

Background

This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF842
Species: Hu
Applications: WB
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP1-32907
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-07799
Species: Hu
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60052
Species: Hu
Applications: WB
H00008034-M01
Species: Hu
Applications: WB, ELISA

Publications for GDC Antibody (H00008034-M01) (0)

There are no publications for GDC Antibody (H00008034-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDC Antibody (H00008034-M01) (0)

There are no reviews for GDC Antibody (H00008034-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDC Antibody (H00008034-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GDC Products

Bioinformatics Tool for GDC Antibody (H00008034-M01)

Discover related pathways, diseases and genes to GDC Antibody (H00008034-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDC Antibody (H00008034-M01)

Discover more about diseases related to GDC Antibody (H00008034-M01).
 

Pathways for GDC Antibody (H00008034-M01)

View related products by pathway.

Blogs on GDC

There are no specific blogs for GDC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDC Antibody (1H7) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A16
Entrez
Uniprot