GCAT Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GCAT Antibody [NBP1-81564] - Staining of human cell line U-2 OS shows localization to nuclear speckles & mitochondria.
Immunohistochemistry: GCAT Antibody [NBP1-81564] - Staining of human pancreas shows moderate cytoplasmic positivity in with a granular pattern in exocrine and endocrine cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGA
Specificity
Specificity of human GCAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GCAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GCAT Protein (NBP1-81564PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCAT Antibody

  • 2-amino-3-ketobutyrate-CoA ligase
  • AKB ligase
  • Aminoacetone synthase
  • EC 2.3.1
  • EC 2.3.1.29
  • Glycine acetyltransferase
  • glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase)
  • glycine C-acetyltransferase
  • KBL2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial
  • MGC23053

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67286
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
7270-IL/CF
Species: Hu
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
AF1633
Species: Mu
Applications: WB

Publications for GCAT Antibody (NBP1-81564) (0)

There are no publications for GCAT Antibody (NBP1-81564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCAT Antibody (NBP1-81564) (0)

There are no reviews for GCAT Antibody (NBP1-81564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GCAT Antibody (NBP1-81564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GCAT Antibody (NBP1-81564)

Discover related pathways, diseases and genes to GCAT Antibody (NBP1-81564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCAT Antibody (NBP1-81564)

Discover more about diseases related to GCAT Antibody (NBP1-81564).
 

Pathways for GCAT Antibody (NBP1-81564)

View related products by pathway.

PTMs for GCAT Antibody (NBP1-81564)

Learn more about PTMs related to GCAT Antibody (NBP1-81564).

Blogs on GCAT

There are no specific blogs for GCAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCAT