GBX2 Antibody (1C11)

Images

 
Immunocytochemistry/ Immunofluorescence: GBX2 Antibody (1C11) [H00002637-M04] - Analysis of monoclonal antibody to GBX2 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
1C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GBX2 Antibody (1C11) Summary

Immunogen
GBX2 (NP_001476 114 a.a. - 182 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG
Specificity
GBX2 (1C11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GBX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GBX2 Antibody (1C11)

  • Gastrulation and brain-specific homeobox protein 2
  • gastrulation brain homeo box 2
  • gastrulation brain homeobox 2
  • GBX2
  • homeobox protein GBX-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

423-F8/CF
Species: Hu, Mu
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
H00002019-M04
Species: Hu
Applications: WB, ELISA, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00002020-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-30817
Species: Hu
Applications: IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF3487
Species: Hu
Applications: WB, IHC, ICC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24691
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002637-M04
Species: Hu
Applications: ELISA, ICC/IF

Publications for GBX2 Antibody (H00002637-M04) (0)

There are no publications for GBX2 Antibody (H00002637-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBX2 Antibody (H00002637-M04) (0)

There are no reviews for GBX2 Antibody (H00002637-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GBX2 Antibody (H00002637-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GBX2 Products

Bioinformatics Tool for GBX2 Antibody (H00002637-M04)

Discover related pathways, diseases and genes to GBX2 Antibody (H00002637-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBX2 Antibody (H00002637-M04)

Discover more about diseases related to GBX2 Antibody (H00002637-M04).
 

Pathways for GBX2 Antibody (H00002637-M04)

View related products by pathway.

PTMs for GBX2 Antibody (H00002637-M04)

Learn more about PTMs related to GBX2 Antibody (H00002637-M04).
 

Research Areas for GBX2 Antibody (H00002637-M04)

Find related products by research area.

Blogs on GBX2

There are no specific blogs for GBX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GBX2 Antibody (1C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol GBX2
Entrez
OMIM
Uniprot