GATC Antibody

Western Blot: GATC Antibody [NBP1-98402] - THP-1 Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GATC Antibody Summary

• Immunogen: The immunogen for this antibody is GATC - N-terminal region. Peptide sequence GLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GATC Antibody

• FLJ37000
• gatC
• glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)
• MGC129938,15E1.2gatC-like protein
• Protein 15E1.2

Background

GATC allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GATC
• Uniprot:
  • NP_789788(Human)