Home » GATC » GATC Antibodies » GATC Antibody

GATC Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: GATC Antibody [NBP1-98402] - THP-1 Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%
Western Blot: GATC Antibody [NBP1-98402] - THP-1 Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GATC Antibody Summary

Immunogen
The immunogen for this antibody is GATC - N-terminal region. Peptide sequence GLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLE.
Clonality
Polyclonal
Host
Rabbit
Gene
GATC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GATC Antibody

  • FLJ37000
  • gatC
  • glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)
  • MGC129938,15E1.2gatC-like protein
  • Protein 15E1.2

Background

GATC allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Low Density LRP
Antibody (1C8G6)
NBP2-52506
Western Blot: Low Density LRP Antibody (1C8G6) [NBP2-52506] - Analysis using LRP1 mAb against human LRP1 (AA: 20-155) recombinant protein. (Expected MW is 40.8 kDa)
Immunohistochemistry: Low Density LRP Antibody (1C8G6) [NBP2-52506] - Analysis of paraffin-embedded rectum cancer tissues using LRP1 mouse mAb with DAB staining.
Western Blot: Low Density LRP Antibody (1C8G6) [NBP2-52506] - Western blot analysis using LRP1 mAb against HEK293 (1) and LRP1 (AA: 20-155)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
MVP Antibody
NBP1-82820
Western Blot: MVP Antibody [NBP1-82820] - Analysis in human cell line A-549.
Immunocytochemistry/Immunofluorescence: MVP Antibody [NBP1-82820] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
RPSA Antibody
NBP1-33002
Western Blot: RPSA Antibody [NBP1-33002] - Whole cell extracts (30 ug) was separated by 10 % SDS-PAGE, and blotted with RPSA antibody diluted by 1:1000
Immunohistochemistry-Paraffin: RPSA Antibody [NBP1-33002] - Paraffin-embedded CA922 xenograft, using antibody at 1:500 dilution.
Western Blot: RPSA Antibody [NBP1-33002] - Sample (50 ug of whole cell lysate) A: mouse brain 12% SDS PAGE; antibody diluted at 1:1000.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PTP alpha/PTPRA
Antibody
NLS6792
Immunohistochemistry-Paraffin: PTP alpha/PTPRA Antibody [NLS6792] - Anti-PTPRA antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 10 ug/ml.
Immunohistochemistry-Paraffin: PTP alpha/PTPRA Antibody [NLS6792] - Analysis of anti-PTPRA antibody with human heart at dilution 10 ug/ml.
(1 Publication)
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Prostatic Acid
Phosphatase/ACPP Anti ...
MAB6240
Western blot shows lysates of human prostate tissue. PVDF Membrane was probed with 2 µg/mL of Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB6240) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB6240) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
PAPOLA Antibody
NBP1-87345
Immunocytochemistry/Immunofluorescence: PAPOLA Antibody [NBP1-87345] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PAPOLA Antibody [NBP1-87345] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MRPS30 Antibody
NBP1-87343
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Reg3A Antibody
NBP2-24763
Western Blot: Reg3a Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Reg3a Antibody [NBP2-24763] - Formalin-fixed, paraffin-embedded human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.
(1 Publication)
Species: Hu, Pm
Applications: WB, IHC-P
TUSC2 Antibody
NBP1-36999
TUSC2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA
PDAP1 Antibody
NBP2-38621
Immunocytochemistry/Immunofluorescence: PDAP1 Antibody [NBP2-38621] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: PDAP1 Antibody [NBP2-38621] - Staining of human tonsil shows cytoplasmic positivity mainly in germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PAG3 Antibody
NBP2-24614
Western Blot: PAG3 Antibody [NBP2-24614] - Analysis of ASAP2 in human brain lysate using 1) preimmune sera at 1:5000 and 2) protein A purified this antibody. 1.0 ug/ml.
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
ASAP1 [p Tyr782]
Antibody
NBP1-77933
Immunocytochemistry/Immunofluorescence: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Analysis of phosphorylated ASAP1present in mouse NIH3T3 cells transfected with activated Src. Specific staining is not present when antibody is pre-incubated with the immunizing peptide prior to reaction with cells.
Immunohistochemistry: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Used at 20 g/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate intracellular positive staining in epidermal keratinocytes in human skin at 40X. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain. Personal Communi-cation, Tina Roush, LifeSpanBiosciences, Seattle, WA.
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
GLYAT Antibody
(4D1)
NBP2-45897
Western Blot: GLYAT Antibody (4D1) [NBP2-45897] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GLYAT.
Immunohistochemistry: GLYAT Antibody (4D1) [NBP2-45897] - Analysis of Carcinoma of Human liver tissue.(Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: GLYAT Antibody (4D1) [NBP2-45897] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
QRSL Antibody
NBP1-87992
Western Blot: QRSL Antibody [NBP1-87992] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: QRSL Antibody [NBP1-87992] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
Western Blot: QRSL Antibody [NBP1-87992] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
GATA-1 Antibody
NBP1-84792
Western Blot: GATA-1 Antibody [NBP1-84792] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: GATA-1 Antibody [NBP1-84792] - Staining of human cell line U-251MG shows positivity in nucleus and nuclear membrane.
Immunohistochemistry-Paraffin: GATA-1 Antibody [NBP1-84792] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CD77 Synthase
Antibody
NBP2-57614
Immunocytochemistry/Immunofluorescence: CD77 Synthase Antibody [NBP2-57614] - Staining of human cell line U-2 OS shows localization to nuclear bodies & mitochondria.
Species: Hu
Applications: ICC/IF
B3GALNT1 Antibody
NBP1-59448
Western Blot: B3GALNT1 Antibody [NBP1-59448] - Human Stomach, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.
Species: Hu
Applications: IHC, IHC-P
DNASE1 Antibody
NBP1-84999
Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human duodenum shows strong cytoplasmic positivity in goblet cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
GATC Antibody
NBP1-98402
GATC Antibody
Species: Hu
Applications: WB

Publications for GATC Antibody (NBP1-98402) (0)

There are no publications for GATC Antibody (NBP1-98402).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATC Antibody (NBP1-98402) (0)

There are no reviews for GATC Antibody (NBP1-98402). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATC Antibody (NBP1-98402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GATC Antibody Products

Related Products by Gene

A4GALT, ACPP, ASAP1, ASAP2, B3GALNT1, DNASE1, GATA1, GLYAT, LRP1, MRPS30, MTASE, MVP, PAPOLA, PDAP1, PRM1, PTPRA, QRSL1, REG3A, RPSA, TUSC2

Bioinformatics Tool for GATC Antibody (NBP1-98402)

Discover related pathways, diseases and genes to GATC Antibody (NBP1-98402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATC Antibody (NBP1-98402)

Discover more about diseases related to GATC Antibody (NBP1-98402).
 

Pathways for GATC Antibody (NBP1-98402)

View related products by pathway.

PTMs for GATC Antibody (NBP1-98402)

Learn more about PTMs related to GATC Antibody (NBP1-98402).

Blogs on GATC

There are no specific blogs for GATC, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATC Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GATC
Uniprot

Customers Who Bought This Also Bought