GATC Antibody

Images

 
Western Blot: GATC Antibody [NBP1-98402] - THP-1 Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

GATC Antibody Summary

Immunogen
The immunogen for this antibody is GATC - N-terminal region. Peptide sequence GLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLE.
Clonality
Polyclonal
Host
Rabbit
Gene
GATC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GATC Antibody

  • FLJ37000
  • gatC
  • glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)
  • MGC129938,15E1.2gatC-like protein
  • Protein 15E1.2

Background

GATC allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82820
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-87345
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24643
Species: Mu
Applications: WB
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-62583
Species: Hu
Applications: WB
H00008706-T01
Species: Hu
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98402
Species: Hu
Applications: WB

Publications for GATC Antibody (NBP1-98402) (0)

There are no publications for GATC Antibody (NBP1-98402).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATC Antibody (NBP1-98402) (0)

There are no reviews for GATC Antibody (NBP1-98402). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATC Antibody (NBP1-98402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GATC Antibody Products

Related Products by Gene

Bioinformatics Tool for GATC Antibody (NBP1-98402)

Discover related pathways, diseases and genes to GATC Antibody (NBP1-98402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATC Antibody (NBP1-98402)

Discover more about diseases related to GATC Antibody (NBP1-98402).
 

Pathways for GATC Antibody (NBP1-98402)

View related products by pathway.

PTMs for GATC Antibody (NBP1-98402)

Learn more about PTMs related to GATC Antibody (NBP1-98402).

Blogs on GATC

There are no specific blogs for GATC, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol GATC
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98402 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought