Home » GATC » GATC Antibodies » GATC Antibody

GATC Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: GATC Antibody [NBP1-98402] - THP-1 Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%
Western Blot: GATC Antibody [NBP1-98402] - THP-1 Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GATC Antibody Summary

Immunogen
The immunogen for this antibody is GATC - N-terminal region. Peptide sequence GLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GATC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GATC Antibody

  • FLJ37000
  • gatC
  • glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)
  • MGC129938,15E1.2gatC-like protein
  • Protein 15E1.2

Background

GATC allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LRP-1 Cluster III
Antibody (SA0290)
NBP2-67286
Western Blot: LRP-1 Cluster III Antibody (SA0290) [NBP2-67286] - Analysis of LRP1 on different lysates using anti-LRP1 antibody at 1/1,000 dilution. Positive control: Lane 1: Mouse liver Lane 2: Mouse brain Lane Lane 3: Mouse lung Lane 4: Human liver Lane 5: HepG2 Lane 6: Human lung
Immunocytochemistry/Immunofluorescence: LRP-1 Cluster III Antibody (SA0290) [NBP2-67286] - Staining LRP1 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: LRP-1 Cluster III Antibody (SA0290) [NBP2-67286] - Analysis of paraffin-embedded mouse liver tissue using anti-LRP1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MVP Antibody
NBP1-82820
Western Blot: MVP Antibody [NBP1-82820] - Analysis in human cell lines A-549 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Immunocytochemistry/Immunofluorescence: MVP Antibody [NBP1-82820] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MVP Antibody [NBP1-82820] - Staining in human colon and pancreas tissues using anti-MVP antibody. Corresponding MVP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
RPSA Antibody
(JF0955)
NBP2-67117
Western Blot: RPSA Antibody (JF0955) [NBP2-67117] - Analysis of RPSA on different lysates using anti-RPSA antibody at 1/1,000 dilution. Positive control: Lane 1: K562 Lane 2: HepG2 Lane 3: A431
Immunocytochemistry/Immunofluorescence: RPSA Antibody (JF0955) [NBP2-67117] - Staining RPSA in RH-35 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: RPSA Antibody (JF0955) [NBP2-67117] - Analysis of paraffin-embedded mouse kidney tissue using anti-RPSA antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
PTP alpha/PTPRA
Antibody
NLS6792
Immunohistochemistry-Paraffin: PTP alpha/PTPRA Antibody [NLS6792] - Anti-PTPRA antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 10 ug/ml.
Immunohistochemistry-Paraffin: PTP alpha/PTPRA Antibody [NLS6792] - Analysis of anti-PTPRA antibody with human heart at dilution 10 ug/ml.
(1 Publication)
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC
PAPOLA Knockout
293T Cell Lysate
NBP2-65899
PAPOLA Knockout 293T Cell Lysate
Species: Hu
MRPS30 Antibody
NBP1-87343
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Reg3A Antibody
NBP2-24763
Western Blot: Reg3a Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Reg3a Antibody [NBP2-24763] - Formalin-fixed, paraffin-embedded human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.
(1 Publication)
Species: Hu, Pm
Applications: WB, IHC-P
TUSC2 Antibody
NBP1-36999
TUSC2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA
PDAP1 Knockout
293T Cell Lysate
NBP2-65749
PDAP1 Knockout 293T Cell Lysate
Species: Hu
PAG3 Antibody
NBP2-24614
Western Blot: PAG3 Antibody [NBP2-24614] - Analysis of ASAP2 in human brain lysate using 1) preimmune sera at 1:5000 and 2) protein A purified this antibody. 1.0 ug/ml.
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
ASAP1 [p Tyr782]
Antibody
NBP1-77933
Immunocytochemistry/Immunofluorescence: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Analysis of phosphorylated ASAP1present in mouse NIH3T3 cells transfected with activated Src. Specific staining is not present when antibody is pre-incubated with the immunizing peptide prior to reaction with cells.
Immunohistochemistry: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Used at 20 g/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate intracellular positive staining in epidermal keratinocytes in human skin at 40X. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain. Personal Communication, Tina Roush, LifeSpanBiosciences, Seattle, WA.
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
GLYAT Antibody
NBP2-55298
Western Blot: GLYAT Antibody [NBP2-55298] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining in human kidney and skeletal muscle tissues using anti-GLYAT antibody. Corresponding GLYAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining of human kidney shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
QRSL Antibody
NBP1-87992
Western Blot: QRSL Antibody [NBP1-87992] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: QRSL Antibody [NBP1-87992] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
Western Blot: QRSL Antibody [NBP1-87992] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
GATA-1 Antibody
(4F5)
NBP1-47492
Western Blot: GATA-1 Antibody (4F5) [NBP1-47492] - Western blot analysis using GATA1 mouse mAb against K562 (1) cell lysate.
Immunocytochemistry/Immunofluorescence: GATA-1 Antibody (4F5) [NBP1-47492] - Immunofluorescence analysis of K562(left) cells using GATA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry: GATA-1 Antibody (4F5) [NBP1-47492] - Immunohistochemical analysis of paraffin-embedded pancreatic cancer, using GATA1 mouse mAb with DAB staining.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
CD77 Synthase
Antibody
NBP2-57614
Immunocytochemistry/Immunofluorescence: CD77 Synthase Antibody [NBP2-57614] - Staining of human cell line U-2 OS shows localization to nuclear bodies & mitochondria.
Species: Hu
Applications: ICC/IF
Recombinant Human
B3GALNT1 Protein
H00008706-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining in human testis and endometrium tissues.. Corresponding PRM1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Species: Hu
Applications: IHC, IHC-P
DNASE1 Antibody
NBP1-84999
Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining in human duodenum and liver tissues using anti-DNASE1 antibody. Corresponding DNASE1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Analysis in human duodenum and liver tissues using Anti-DNASE1 antibody. Corresponding DNASE1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
GATC Antibody
NBP1-98402
GATC Antibody
Species: Hu
Applications: WB

Publications for GATC Antibody (NBP1-98402) (0)

There are no publications for GATC Antibody (NBP1-98402).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATC Antibody (NBP1-98402) (0)

There are no reviews for GATC Antibody (NBP1-98402). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATC Antibody (NBP1-98402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GATC Antibody (NBP1-98402)

Discover related pathways, diseases and genes to GATC Antibody (NBP1-98402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATC Antibody (NBP1-98402)

Discover more about diseases related to GATC Antibody (NBP1-98402).
 

Pathways for GATC Antibody (NBP1-98402)

View related products by pathway.

PTMs for GATC Antibody (NBP1-98402)

Learn more about PTMs related to GATC Antibody (NBP1-98402).

Blogs on GATC

There are no specific blogs for GATC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATC Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GATC
Uniprot