GATA-3 Antibody

Images

 
Western Blot: GATA-3 Antibody [NBP1-83271] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Immunohistochemistry-Paraffin: GATA-3 Antibody [NBP1-83271] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GATA-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GATA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
GATA-3 Protein (NBP1-83271PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GATA-3 Antibody

  • 131320
  • GATA binding protein 3
  • GATA3
  • GATA-3
  • GATA-binding factor 3
  • GATA-binding protein 3
  • HDRMGC5199
  • MGC2346
  • MGC5445
  • trans-acting T-cell-specific transcription factor GATA-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-25241
Species: Hu, Mu
Applications: WB, IP
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82581
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-51541
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-83271
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GATA-3 Antibody (NBP1-83271) (0)

There are no publications for GATA-3 Antibody (NBP1-83271).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-3 Antibody (NBP1-83271) (0)

There are no reviews for GATA-3 Antibody (NBP1-83271). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATA-3 Antibody (NBP1-83271) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GATA-3 Antibody Products

Related Products by Gene

Bioinformatics Tool for GATA-3 Antibody (NBP1-83271)

Discover related pathways, diseases and genes to GATA-3 Antibody (NBP1-83271). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-3 Antibody (NBP1-83271)

Discover more about diseases related to GATA-3 Antibody (NBP1-83271).
 

Pathways for GATA-3 Antibody (NBP1-83271)

View related products by pathway.

PTMs for GATA-3 Antibody (NBP1-83271)

Learn more about PTMs related to GATA-3 Antibody (NBP1-83271).
 

Research Areas for GATA-3 Antibody (NBP1-83271)

Find related products by research area.

Blogs on GATA-3

There are no specific blogs for GATA-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATA-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA3
Entrez

Customers Who Bought This Also Bought