GATA-2 Antibody (2F12)

Images

 
Western Blot: GATA-2 Antibody (2F12) [H00002624-M03] - Analysis of GATA2 expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: GATA-2 Antibody (2F12) [H00002624-M03] - Analysis of monoclonal antibody to GATA2 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: GATA-2 Antibody (2F12) [H00002624-M03] - Detection limit for recombinant GST tagged GATA2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2F12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GATA-2 Antibody (2F12) Summary

Immunogen
GATA2 (AAH18988, 1 a.a. - 102 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK
Localization
Nuclear
Specificity
GATA2 - GATA binding protein 2
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
GATA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GATA-2 Antibody (2F12)

  • endothelial transcription factor GATA-2
  • FLJ45948
  • GATA binding protein 2
  • GATA2
  • GATA-2
  • GATA-binding protein 2NFE1B
  • MGC2306

Background

The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells (Tsai et al., 1994 [PubMed 8078582]). GATA1 (MIM 305371) is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells. In chicken erythroid progenitors, forced expression of GATA2 promotes proliferation at the expense of differentiation (Briegel et al., 1993 [PubMed 8504932]). GATA3 (MIM 131320) expression is restricted to T-lymphoid cells and some nonhematopoietic cell types, including embryonic stem cells.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17791
Species: Hu, Mu
Applications: WB
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-68241
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-57016
Species: Hu
Applications: WB
NB110-83978
Species: Hu, Mu, Rt, Bv
Applications: WB, ChIP, IHC, IHC-P
H00002624-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GATA-2 Antibody (H00002624-M03) (0)

There are no publications for GATA-2 Antibody (H00002624-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-2 Antibody (H00002624-M03) (0)

There are no reviews for GATA-2 Antibody (H00002624-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GATA-2 Antibody (H00002624-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GATA-2 Products

Bioinformatics Tool for GATA-2 Antibody (H00002624-M03)

Discover related pathways, diseases and genes to GATA-2 Antibody (H00002624-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-2 Antibody (H00002624-M03)

Discover more about diseases related to GATA-2 Antibody (H00002624-M03).
 

Pathways for GATA-2 Antibody (H00002624-M03)

View related products by pathway.

PTMs for GATA-2 Antibody (H00002624-M03)

Learn more about PTMs related to GATA-2 Antibody (H00002624-M03).

Blogs on GATA-2

There are no specific blogs for GATA-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATA-2 Antibody (2F12) and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA2
Entrez
OMIM
Uniprot