GATA-2 Antibody (2F12) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
GATA2 (AAH18988, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK |
| Localization |
Nuclear |
| Specificity |
GATA2 - GATA binding protein 2 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
GATA2 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GATA-2 Antibody (2F12) - Azide and BSA Free
Background
The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells (Tsai et al., 1994 [PubMed 8078582]). GATA1 (MIM 305371) is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells. In chicken erythroid progenitors, forced expression of GATA2 promotes proliferation at the expense of differentiation (Briegel et al., 1993 [PubMed 8504932]). GATA3 (MIM 131320) expression is restricted to T-lymphoid cells and some nonhematopoietic cell types, including embryonic stem cells.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: Flow, ICC, WB
Publications for GATA-2 Antibody (H00002624-M03) (0)
There are no publications for GATA-2 Antibody (H00002624-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GATA-2 Antibody (H00002624-M03) (0)
There are no reviews for GATA-2 Antibody (H00002624-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GATA-2 Antibody (H00002624-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GATA-2 Products
Research Areas for GATA-2 Antibody (H00002624-M03)
Find related products by research area.
|
Blogs on GATA-2