GAT3 Antibody - BSA Free

Western Blot: GAT3 Antibody [NBP2-84955] - Host: Rabbit. Target Name: SLC6A11. Sample Type: PANC1 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GAT3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GAT3. Peptide sequence: EGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAIT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC6A11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GAT3 Antibody - BSA Free

• GABA Transporter 3
• GABT3
• GAT-3
• GAT3sodium- and chloride-dependent GABA transporter 3
• GAT4
• solute carrier family 6 (neurotransmitter transporter, GABA), member 11
• Solute carrier family 6 member 11

Background

Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system, causing a hyperpolarization of the membrane through the opening of a Cl negative channel associated with the GABAA receptor (GABAA-R) subtype. GABA plasma membrane transporters (GATs) influence synaptic neurotransmission by high-affinity uptake and release of GABA. To date, four distinct GABA transporters have been identified: GAT-1, GAT-2, GAT-3, and BGT-1. GAT-3 has been found to be localized to astrocytes within the cerebral cortex indicating that this transporter mediates GABA uptake into glial cells (Minelli et al., 1996).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A11