![Sandwich ELISA: GAT3 Antibody (2C3) [H00006538-M10] - Detection limit for recombinant GST tagged SLC6A11 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/GAT3-Antibody-2C3-Sandwich-ELISA-H00006538-M10-img0001.jpg "Sandwich ELISA: GAT3 Antibody (2C3) [H00006538-M10] - Detection limit for recombinant GST tagged SLC6A11 is 0.1 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2C3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC6A11 (NP_055044.1, 164 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLR |
| Specificity | Reacts with solute carrier family 6 (neurotransmitter transporter, GABA), member 11. |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC6A11 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is reactive against recombinant protein in WB and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00006538-M10 | Applications | Species |
|---|---|---|
| Lee M, McGeer EG, McGeer PL. Mechanisms of GABA release from human astrocytes. Glia 2011-11-01 [PMID: 21748804] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
Research Areas for GAT3 Antibody (H00006538-M10)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD2_AF2247_Immunohistochemistry_20053.jpg)
![Western Blot Carbonic Anhydrase III/CA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_III_AF2185_Western_Blot_20454.jpg)
