GAS8 Antibody

Images

 
Western Blot: GAS8 Antibody [NBP2-14037] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: GAS8 Antibody [NBP2-14037] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: GAS8 Antibody [NBP2-14037] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAS8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQV CKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAS8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GAS8 Protein (NBP2-14037PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAS8 Antibody

  • GAS-11
  • GAS11MGC138326
  • GAS-8
  • growth arrest specific 11
  • growth arrest-specific 11
  • growth arrest-specific 8
  • Growth arrest-specific protein 11
  • growth arrest-specific protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-08210
Species: Hu
423-F8/CF
Species: Hu, Mu
AF885
Species: Hu
Applications: WB, IHC
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
232-FA/CF
Species: Hu
AF5510
Species: Hu
Applications: WB
H00002620-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-755
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-03061
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1951
Species: Hu, Mu, Rt, Bv, Ch, Fe, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24567
Species: Hu
Applications: WB
NBP2-14037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GAS8 Antibody (NBP2-14037) (0)

There are no publications for GAS8 Antibody (NBP2-14037).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAS8 Antibody (NBP2-14037) (0)

There are no reviews for GAS8 Antibody (NBP2-14037). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GAS8 Antibody (NBP2-14037) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAS8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAS8