GAS8 Antibody - BSA Free

Immunohistochemistry-Paraffin: GAS8 Antibody [NBP2-14037] - Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GAS8 Antibody [NBP2-14037] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: GAS8 Antibody [NBP2-14037] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GAS8 Antibody [NBP2-14037] - Staining of human breast shows moderate to strong cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GAS8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAS8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GAS8 Protein (NBP2-14037PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GAS8 Antibody - BSA Free

• GAS-11
• GAS11MGC138326
• GAS-8
• growth arrest specific 11
• growth arrest-specific 11
• growth arrest-specific 8
• Growth arrest-specific protein 11
• growth arrest-specific protein 8

Background

GAS8 includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene. Transcript Variant: This variant (1) is predicted to encode a protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAS8