GAS2 Antibody (4E11)

Images

 
Western Blot: GAS2 Antibody (4E11) [H00002620-M01] - Analysis of GAS2 expression in transfected 293T cell line by GAS2 monoclonal antibody (M01), clone 4E11.Lane 1: GAS2 transfected lysate(34.9 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: GAS2 Antibody (4E11) [H00002620-M01] - Analysis of monoclonal antibody to GAS2 on NIH/3T3 cell. Antibody concentration 10 ug/ml.
Western Blot: GAS2 Antibody (4E11) [H00002620-M01] - GAS2 monoclonal antibody (M01), clone 4E11 Analysis of GAS2 expression in NIH/3T3.
Sandwich ELISA: GAS2 Antibody (4E11) [H00002620-M01] - Detection limit for recombinant GST tagged GAS2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
4E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GAS2 Antibody (4E11) Summary

Immunogen
GAS2 (NP_005247, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR
Specificity
GAS2 (4E11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GAS2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Control
NIH 3T3 Whole Cell Lysate
Publications
Read Publication using H00002620-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GAS2 Antibody (4E11)

  • GAS-2
  • growth arrest-specific 2
  • growth arrest-specific protein 2
  • MGC32610

Background

The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP, KD
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32310
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06542
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45511
Species: Hu, Mu, Rt
Applications: WB, IHC
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-36528
Species: Hu, Mu
Applications: IP (-), WB
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GAS2 Antibody (H00002620-M01)(1)

Reviews for GAS2 Antibody (H00002620-M01) (0)

There are no reviews for GAS2 Antibody (H00002620-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GAS2 Antibody (H00002620-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GAS2 Products

Bioinformatics Tool for GAS2 Antibody (H00002620-M01)

Discover related pathways, diseases and genes to GAS2 Antibody (H00002620-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAS2 Antibody (H00002620-M01)

Discover more about diseases related to GAS2 Antibody (H00002620-M01).
 

Pathways for GAS2 Antibody (H00002620-M01)

View related products by pathway.

PTMs for GAS2 Antibody (H00002620-M01)

Learn more about PTMs related to GAS2 Antibody (H00002620-M01).
 

Research Areas for GAS2 Antibody (H00002620-M01)

Find related products by research area.

Blogs on GAS2

There are no specific blogs for GAS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAS2 Antibody (4E11) and receive a gift card or discount.

Bioinformatics

Gene Symbol GAS2
Entrez
OMIM
Uniprot