GAS8 Antibody - BSA Free

Western Blot: GAS8 Antibody [NBP1-55508] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.

Species tissue/cell type: Human nasal epithelial cellsPrimary antibody dilution: 1:1200Secondary antibody: Goat anti-rabbit Alexa Fluor 546Secondary antibody dilution:1:1000

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GAS8 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GAS8(growth arrest-specific 8) The peptide sequence was selected from the middle region of GAS8. Peptide sequence RALKVELKEQELASEVVVKNLRLKHTEEITRMRNDFERQVREIEAKYDKK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAS8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 : 1200
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GAS8 Antibody - BSA Free

• GAS-11
• GAS11MGC138326
• GAS-8
• growth arrest specific 11
• growth arrest-specific 11
• growth arrest-specific 8
• Growth arrest-specific protein 11
• growth arrest-specific protein 8

Background

This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAS8
• Uniprot:
  • O95995(Human)