Gas6 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Gas6 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAS6.
  
  

  Source: E. coli

  Amino Acid Sequence: STWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GAS6
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90059.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gas6 Recombinant Protein Antigen

• AXLLG
• AXLLGAXL stimulatory factor
• AXSFAXL receptor tyrosine kinase ligand
• DKFZp666G247
• FLJ34709
• Gas6
• GAS-6
• growth arrest-specific 6
• growth arrest-specific protein 6

Background

Growth arrest specific proteins, including Gas1 and Gas6, are activated in quiescent cells. Gas1-induced growth arrest is mediated by p53, and Gas1 appears to be able to suppress tumor cell growth. Gas6, a ligand for the tyrosine kinase receptor Axl, was initially identified as a member of the vitamin K-dependent protein family and exhibits a high degree of amino acid sequence homology to protein S, a negative co-regulator in the coagulation pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GAS6