GAP1m Antibody


Western Blot: GAP1m Antibody [NBP2-32019] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-233
Immunohistochemistry: GAP1m Antibody [NBP2-32019] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Western Blot: GAP1m Antibody [NBP2-32019] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-232
Immunohistochemistry: GAP1m Antibody [NBP2-32019] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GAP1m Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGK
Specificity of human GAP1m antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GAP1m Protein (NBP2-32019PEP)
Read Publication using
NBP2-32019 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%). Human reactivity reported in scientific literature (PMID: 26502337).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GAP1m Antibody

  • RASA2 RAS p21 protein activator 2
  • RASA2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
Species: Hu, Mu, Rt
Applications: WB
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Ma
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GAP1m Antibody (NBP2-32019)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for GAP1m Antibody (NBP2-32019) (0)

There are no reviews for GAP1m Antibody (NBP2-32019). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAP1m Antibody (NBP2-32019) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GAP1m Products

GAP1m NBP2-32019

Bioinformatics Tool for GAP1m Antibody (NBP2-32019)

Discover related pathways, diseases and genes to GAP1m Antibody (NBP2-32019). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAP1m Antibody (NBP2-32019)

Discover more about diseases related to GAP1m Antibody (NBP2-32019).

Pathways for GAP1m Antibody (NBP2-32019)

View related products by pathway.

PTMs for GAP1m Antibody (NBP2-32019)

Learn more about PTMs related to GAP1m Antibody (NBP2-32019).

Blogs on GAP1m

There are no specific blogs for GAP1m, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GAP1m Antibody and receive a gift card or discount.


Gene Symbol RASA2