GAP1m Antibody - BSA Free

Immunohistochemistry: GAP1m Antibody [NBP2-32019] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GAP1m Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GAP1m Antibody - BSA Free (NBP2-32019) is a polyclonal antibody validated for use in IHC. Anti-GAP1m Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GAP1m Protein (NBP2-32019PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Human reactivity reported in scientific literature (PMID: 26502337).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GAP1m Antibody - BSA Free

• RASA2 RAS p21 protein activator 2
• RASA2

Background

GAP1M is a member of the GAP1 family of GTPase-activating proteins. GAP1m stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances the weak intrinsic GTPase activity of RAS proteins resulting in the inactive GDP-bound form of RAS, thereby allowing control of cellular proliferation and differentiation. This particular family member has a perinuclear localization and is an inositol 1,3,4,5-tetrakisphosphate-binding protein; a compound suggested to function as a second messenger. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GAP1m Antibody (NBP2-32019)(1)

Publication using NBP2-32019

• Rand Arafeh, Nouar Qutob, Rafi Emmanuel et al. Recurrent inactivating RASA2 mutations in melanoma. Nature Genetics 2015-10-26 [PMID: 26502337] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: RASA2
• Uniprot:
  • Q15283(Human)