GANC Antibody

Images

 
Western Blot: GANC Antibody [NBP1-56805] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GANC Antibody Summary

Immunogen
Synthetic peptides corresponding to GANC(glucosidase, alpha; neutral C) The peptide sequence was selected from the middle region of GANC. Peptide sequence VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GANC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GANC and was validated on Western blot.
Control
GANC Lysate (NBP2-66268)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GANC Antibody

  • EC 3.2.1
  • EC 3.2.1.20
  • glucosidase, alpha; neutral C
  • MGC138256
  • neutral alpha-glucosidase C

Background

GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. This gene encodes a member of glycosyl hydrolases family 31. This enzyme hydrolyses terminal, non-reducing 1,4-linked alpha-D-glucose residues and releases alpha-D-glucose. This is a key enzyme in glycogen metabolism and its gene localizes to a chromosomal region (15q15) that is associated with susceptibility to diabetes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52575
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
H00347527-P01
Species: Hu
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
6507-IL/CF
Species: Hu
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2720
Species: Hu
Applications: WB, IHC
NBP1-32554
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84563
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
6144-GH
Species: Hu
NBP2-30783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-90095
Species: Hu
Applications: IHC, IHC-P

Publications for GANC Antibody (NBP1-56805) (0)

There are no publications for GANC Antibody (NBP1-56805).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GANC Antibody (NBP1-56805) (0)

There are no reviews for GANC Antibody (NBP1-56805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GANC Antibody (NBP1-56805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GANC Antibody (NBP1-56805)

Discover related pathways, diseases and genes to GANC Antibody (NBP1-56805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GANC Antibody (NBP1-56805)

Discover more about diseases related to GANC Antibody (NBP1-56805).
 

Pathways for GANC Antibody (NBP1-56805)

View related products by pathway.

Blogs on GANC

There are no specific blogs for GANC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GANC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GANC
Uniprot