beta Casein Antibody

Images

 
Immunohistochemistry-Paraffin: beta Casein Antibody [NBP1-88188] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: beta Casein Antibody [NBP1-88188] - Staining of human lactating breast shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: beta Casein Antibody [NBP1-88188] - Staining of human breast shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: beta Casein Antibody [NBP1-88188] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

beta Casein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
beta Casein Protein (NBP1-88188PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for beta Casein Antibody

  • beta-casein
  • CASB
  • casein beta

Background

Useful marker for the investigation of malignancy in breast epithelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for beta Casein Antibody (NBP1-88188) (0)

There are no publications for beta Casein Antibody (NBP1-88188).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta Casein Antibody (NBP1-88188) (0)

There are no reviews for beta Casein Antibody (NBP1-88188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for beta Casein Antibody (NBP1-88188) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional beta Casein Products

Research Areas for beta Casein Antibody (NBP1-88188)

Find related products by research area.

Blogs on beta Casein

There are no specific blogs for beta Casein, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta Casein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSN2