Home » gamma Sarcoglycan » gamma Sarcoglycan Antibodies » gamma Sarcoglycan Antibody

gamma Sarcoglycan Antibody

 (1 Publication)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse protein. Image from verified customer review.
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse ...read more
Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744] - Mouse tibialis anterior frozen sections. Image from verified customer review.
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Human Heart lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-Fr
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

gamma Sarcoglycan Antibody Summary

Immunogen
Synthetic peptides corresponding to SGCG(sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)) The peptide sequence was selected from the middle region of SGCG. Peptide sequence FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGCG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SGCG and was validated on Western blot. Frozen section data from customer review.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-59744 in the following applications:
Publications
Read Publication using
NBP1-59744 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for gamma Sarcoglycan Antibody

  • 35 kDa dystrophin-associated glycoprotein
  • 35DAG
  • A4
  • DAGA4,35kD dystrophin-associated glycoprotein
  • DMDA
  • DMDA1
  • gamma sarcoglycan
  • gamma-sarcoglycan
  • gamma-SG
  • MAM
  • MGC130048
  • sarcoglycan, gamma (35kD dystrophin-associated glycoprotein)
  • sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
  • SCARMD2
  • SCG3LGMD2C
  • TYPE

Background

Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

alpha-Sarcoglycan
Antibody
NBP1-90306
Western Blot: alpha Sarcoglycan Antibody [NBP1-90306] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: alpha Sarcoglycan Antibody [NBP1-90306] - Staining of human heart muscle shows distinct positivity of intercalated discs in myocytes.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
ATP6V0A2 Antibody
NBP1-59069
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - HeLa cells, concentration 3.3 ug/ml.
Immunohistochemistry: ATP6V0A2 Antibody [NBP1-59069] - Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody
Western Blot: ATP6V0A2 Antibody [NBP1-59069] - Hela tissue lysate at a concentration of 1ug/ml.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
GPHA2
Overexpression Lysate
NBL1-11228
Western Blot: GPHA2 Overexpression Lysate (Adult Normal) [NBL1-11228] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for GPHA2.
Species: Hu
TCIRG1 Antibody
NBP1-89333
Immunocytochemistry/Immunofluorescence: TCIRG1 Antibody [NBP1-89333] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCIRG1 Antibody [NBP1-89333] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
ATP6V0A1 Antibody
NBP1-89342
Immunocytochemistry/Immunofluorescence: ATP6V0A1 Antibody [NBP1-89342] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Staining of human cerebral cortex shows high expression.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
RFC1 Antibody
NB100-230
Western Blot: RFC1 Antibody [NB100-230] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-RFC1 antibody (lot was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: RFC1 Antibody [NB100-230] - Samples: Whole cell lysate (50, 15 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RFC1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Proximity Ligation Assay: RFC1 Antibody [NB100-230] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human RFC1 (NB100-230) and rabbit anti-human BLM (NB100-214). Image merged from DAPI (2ms) and Texas Red (200ms) exposures, 40X magnification.
Species: Hu
Applications: WB, IP, PLA
RFC2 Antibody
(OTI2B2)
NBP2-45570
Western Blot: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.
Immunohistochemistry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: RFC2 Antibody (2B2) [NBP2-45570] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by RFC2 antibody.
Species: Hu
Applications: WB, Flow, IHC
RFC4 Antibody
NB100-233
Western Blot: RFC4 Antibody [NB100-233] - Detection of Human and Mouse RFC4 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified goat anti-RFC4 antibody NB100-233 used for WB at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: RFC4 Antibody [NB100-233] - Nuclear extract (50 ug) from HeLa cells. Antibody used at 1 ug/ml.
Proximity Ligation Assay: RFC4 Antibody [NB100-233] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human RFC4 (NB100-233) and rabbit anti-human BRD4 (NBP1-18874). Image merged from DAPI (2ms) and Texas Red (200ms) exposures, 40X magnification.
(1 Publication)
Species: Hu
Applications: WB, PLA
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
Immunohistochemistry-Paraffin: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of a formalin fixed paraffin embedded tissue section of human brain (Alzheimers disease, hippocampus) using 1:200 dilution of anti-beta Amyloid antibody (clone MOAB-2). The staining was developed with HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This beta Amyloid antibody specifically stained the cells with Abeta 42/ Abeta aggregates while the normal cells were negative for abeta peptide.
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).
(12 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
CD19 Antibody
(CB19)
NBP2-25196
Immunocytochemistry/Immunofluorescence: CD19 Antibody (CB19) [NBP2-25196] - The CD19 (CB19) antibody was tested in Daudi cells at a 1:40 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - A surface stain was performed on human peripheral blood lymphocytes with CD9 (HI9a) antibody NB100-77915AF647 and a matched isotype control NBP2-27287AF488. Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature. A co-stain was performed with NBP2-26646.
Flow Cytometry: CD19 Antibody (CB19) [NBP2-25196] - Surface staining of 10^6 human lymphocytes using 0.2 ug of CD19 antibody (red) and isotype control (green). Cell surface staining kit was used for this test.
(10 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
BBS9 Antibody
NBP1-88927
Immunocytochemistry/Immunofluorescence: BBS9 Antibody [NBP1-88927] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human tonsil shows no positivity as expected.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human heart muscle shows strong membranous positivity in myocytes.
Immunohistochemistry-Paraffin: Dystrophin Antibody [NBP1-89953] - Staining of human skeletal muscle shows strong membranous positivity in myocytes.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Complement C4a
Antibody
NBP2-14893
Western Blot: Complement C4a Antibody [NBP2-14893] - Sample (30 ug of whole cell lysate) A: HepG2; 5% SDS PAGE, antibody diluted at 1:500.
Immunohistochemistry-Paraffin: Complement C4a Antibody [NBP2-14893] - Paraffin-embedded Hepatoma, using antibody at 1:200 dilution.
Species: Hu
Applications: WB, IHC, IHC-P
PTK9 Antibody
NBP1-90297
Western Blot: PTK9 Antibody [NBP1-90297] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: PTK9 Antibody [NBP1-90297] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: PTK9 Antibody [NBP1-90297] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
CD20 Antibody
(AISB12)
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow
SPANXB1 Antibody
H00728695-B01P
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
hnRNP C1 + C2
Antibody (CL2596)
NBP2-36777
Western Blot: hnRNP C1 + C2 Antibody (CL2596) [NBP2-36777] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-HNRNPC monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % inten
Immunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (CL2596) [NBP2-36777] - Staining in U251 cell line showing distinct nuclear (without nucleoli)Staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.
Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2596) [NBP2-36777] - Staining of human lymph node shows strong nuclear immunoreactivity in lymphocytes.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Leukotriene A4
Hydrolase/LTA4H Antib ...
NBP1-47829
Western Blot: Leukotriene A4 Hydrolase/LTA4H Antibody (1E9) [NBP1-47829] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Leukotriene A4 hydrolasemonoclonal antibody.
Immunohistochemistry-Paraffin: Leukotriene A4 Hydrolase/LTA4H Antibody (1E9) [NBP1-47829] - Staining of paraffin-embedded prostate tissue using anti-Leukotriene A4 hydrolase mouse monoclonal antibody.
Western Blot: Leukotriene A4 Hydrolase/LTA4H Antibody (1E9) [NBP1-47829] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Leukotriene A4 hydrolase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Leukotriene A4 hydrolase.
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
Complement C3
Antibody (11H9)
NB200-540
Flow (Intracellular): Complement C3 Antibody (11H9) [NB200-540] - An intracellular stain was performed on RAW 246.7 cells with Complement C3 (11H9-3-2) antibody NB200-540 (blue) and a matched isotype control NBP2-31382 (orange). Cells were either treated with 3uM Monensin for 3 hours to block the secretion of Complement C3 (B) or grown in normal media (A). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) PE-conjugated secondary antibody (F0102B, R&D Systems).
Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern.
Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - IHC-P detection of Complement C3 protein in a formalin fixed paraffin embedded tissue section of mouse liver using 1 : 100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining.
(1 Review)
(1 Publication)
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
PLEKHM1 Antibody
NBP1-83013
Western Blot: PLEKHM1 Antibody [NBP1-83013] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells)
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP1-83013] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Species: Hu
Applications: WB, IHC, IHC-P

Publications for gamma Sarcoglycan Antibody (NBP1-59744)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for gamma Sarcoglycan Antibody (NBP1-59744) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.

Reviews using NBP1-59744:
Filter by Applications
IHC-Fr
(1)
WB
(1)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen gamma Sarcoglycan NBP1-59744
Enlarge
reviewed by:
Anonymous
 IHC-Fr Mouse 08/28/2014
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedMouse tibialis anterior
SpeciesMouse

Blocking

Blocking DetailsGoat Normal Serum, 15 min, room temperature

Primary Anitbody

Dilution Ratio1:50, 60min at 37C

Secondary Antibody

Secondary Descriptiongoat anti rabbit IgF-FITC
Secondary Manufacturer Cat#Sigma F9887
Secondary Concentration1:300

Details

Detection NotesImage at 20x, Olympus B-65 Microscope/Camera
Fixation DetailsCut section at 5um, adhered to charged slide. 1) PBS 3x for 5min each 2) 1% Triton for 20min 3)PBS 3x 5min each; all room temp
Wash DescriptionPBS 3x, 5min each.
Western Blot gamma Sarcoglycan NBP1-59744
Enlarge
reviewed by:
Anonymous
 WB Mouse 08/13/2014
View

Summary

ApplicationWestern Blot
Sample TestedMouse Heart, Liver, Quadriceps, and Triceps
SpeciesMouse
LotQC17604-100331
CommentsIncreasing exposure time to ~24 hours did increase signal, but also increased background. Increasing the secondary antibody dilution may help lower background at high exposure times.

Blocking

Blocking Details5% Milk, TBS-Tween 0.1%, 1 hour 4C

Primary Anitbody

Dilution Ratio1:1000 in 5% Milk, TBS-Tween 0.1%. Incubated overnight (~14 hrs) at 4C

Secondary Antibody

Secondary DescriptionDonkey anti-rabbit, HRP
Secondary Manufacturer Cat#Santa Cruz, sc-2305
Secondary Concentration1:10,000

Details

Detection NotesPierce ECL Western Blotting Substrat, # 32106. Exposure time 2 hours.

Comments

CommentsIncreasing exposure time to ~24 hours did increase signal, but also increased background. Increasing the secondary antibody dilution may help lower background at high exposure times.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gamma Sarcoglycan Antibody (NBP1-59744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional gamma Sarcoglycan Products

Bioinformatics Tool for gamma Sarcoglycan Antibody (NBP1-59744)

Discover related pathways, diseases and genes to gamma Sarcoglycan Antibody (NBP1-59744). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma Sarcoglycan Antibody (NBP1-59744)

Discover more about diseases related to gamma Sarcoglycan Antibody (NBP1-59744).
 

Pathways for gamma Sarcoglycan Antibody (NBP1-59744)

View related products by pathway.

Blogs on gamma Sarcoglycan

There are no specific blogs for gamma Sarcoglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Immunohistochemistry-Frozen gamma Sarcoglycan NBP1-59744
Enlarge
 Anonymous
08/28/2014
Application: IHC-Fr
Species: Mouse
read this review
Western Blot gamma Sarcoglycan NBP1-59744
Enlarge
 Anonymous
08/13/2014
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol SGCG
Uniprot