gamma Sarcoglycan Antibody

Images

 
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse ...read more
Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744] - Mouse tibialis anterior frozen sections. Image from verified customer review.
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Human Heart lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

gamma Sarcoglycan Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to SGCG(sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)) The peptide sequence was selected from the middle region of SGCG. Peptide sequence FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGCG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
Frozen section data from customer review.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-59744 in the following applications:

Publications
Read Publications using
NBP1-59744 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Purity
Protein A purified

Alternate Names for gamma Sarcoglycan Antibody

  • 35 kDa dystrophin-associated glycoprotein
  • 35DAG
  • A4
  • DAGA4
  • DAGA4,35kD dystrophin-associated glycoprotein
  • DMDA
  • DMDA1
  • gamma sarcoglycan
  • gamma-Sarcoglycan
  • gamma-SG
  • LGMD2C
  • LGMDR5
  • MAM
  • MGC130048
  • sarcoglycan, gamma (35kD dystrophin-associated glycoprotein)
  • sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
  • SCARMD2
  • SCG3
  • SCG3LGMD2C
  • TYPE

Background

Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15896
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
H00010312-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6457
Species: Hu
Applications: WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP1-90297
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-47829
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for gamma Sarcoglycan Antibody (NBP1-59744)(3)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC-Fr, WB.


Filter By Application
ICC/IF
(1)
IHC-Fr
(2)
WB
(1)
All Applications
Filter By Species
Mouse
(2)
All Species

Reviews for gamma Sarcoglycan Antibody (NBP1-59744) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.

Reviews using NBP1-59744:
Filter by Applications
IHC-Fr
(1)
WB
(1)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen gamma Sarcoglycan NBP1-59744
Enlarge
5
reviewed by:
Verified Customer
IHC-Fr Mouse 08/28/2014
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedMouse tibialis anterior
SpeciesMouse
Western Blot gamma Sarcoglycan NBP1-59744
Enlarge
4
reviewed by:
Verified Customer
WB Mouse 08/13/2014
View

Summary

ApplicationWestern Blot
Sample TestedMouse Heart, Liver, Quadriceps, and Triceps
SpeciesMouse
LotQC17604-100331

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gamma Sarcoglycan Antibody (NBP1-59744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Verified Customer
08/28/2014
Application: IHC-Fr
Species: Mouse

Verified Customer
08/13/2014
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol SGCG
Uniprot