gamma Sarcoglycan Antibody


Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse more
Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744] - Mouse tibialis anterior frozen sections. Image from verified customer review.
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Human Heart lysate, concentration 1.25ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB, IHC, IHC-Fr

Order Details

gamma Sarcoglycan Antibody Summary

Synthetic peptides corresponding to SGCG(sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)) The peptide sequence was selected from the middle region of SGCG. Peptide sequence FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS.
Predicted Species
Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%), Zebrafish (100%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SGCG and was validated on Western blot. Frozen section data from customer review.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 4.5
NBP1-59744 in the following applications:

Read Publication using
NBP1-59744 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for gamma Sarcoglycan Antibody

  • 35 kDa dystrophin-associated glycoprotein
  • 35DAG
  • A4
  • DAGA4,35kD dystrophin-associated glycoprotein
  • DMDA
  • DMDA1
  • gamma sarcoglycan
  • gamma-sarcoglycan
  • gamma-SG
  • MAM
  • MGC130048
  • sarcoglycan, gamma (35kD dystrophin-associated glycoprotein)
  • sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
  • TYPE


Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ChIP, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IF
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for gamma Sarcoglycan Antibody (NBP1-59744)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for gamma Sarcoglycan Antibody (NBP1-59744) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.

Reviews using NBP1-59744:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen gamma Sarcoglycan NBP1-59744
reviewed by:
IHC-Fr Mouse 08/28/2014


Sample TestedMouse tibialis anterior


Blocking DetailsGoat Normal Serum, 15 min, room temperature

Primary Anitbody

Dilution Ratio1:50, 60min at 37C

Secondary Antibody

Secondary Descriptiongoat anti rabbit IgF-FITC
Secondary Manufacturer Cat#Sigma F9887
Secondary Concentration1:300


Detection NotesImage at 20x, Olympus B-65 Microscope/Camera
Fixation DetailsCut section at 5um, adhered to charged slide. 1) PBS 3x for 5min each 2) 1% Triton for 20min 3)PBS 3x 5min each; all room temp
Wash DescriptionPBS 3x, 5min each.
Western Blot gamma Sarcoglycan NBP1-59744
reviewed by:
WB Mouse 08/13/2014


ApplicationWestern Blot
Sample TestedMouse Heart, Liver, Quadriceps, and Triceps
CommentsIncreasing exposure time to ~24 hours did increase signal, but also increased background. Increasing the secondary antibody dilution may help lower background at high exposure times.


Blocking Details5% Milk, TBS-Tween 0.1%, 1 hour 4C

Primary Anitbody

Dilution Ratio1:1000 in 5% Milk, TBS-Tween 0.1%. Incubated overnight (~14 hrs) at 4C

Secondary Antibody

Secondary DescriptionDonkey anti-rabbit, HRP
Secondary Manufacturer Cat#Santa Cruz, sc-2305
Secondary Concentration1:10,000


Detection NotesPierce ECL Western Blotting Substrat, # 32106. Exposure time 2 hours.


CommentsIncreasing exposure time to ~24 hours did increase signal, but also increased background. Increasing the secondary antibody dilution may help lower background at high exposure times.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gamma Sarcoglycan Antibody (NBP1-59744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional gamma Sarcoglycan Products

Bioinformatics Tool for gamma Sarcoglycan Antibody (NBP1-59744)

Discover related pathways, diseases and genes to gamma Sarcoglycan Antibody (NBP1-59744). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma Sarcoglycan Antibody (NBP1-59744)

Discover more about diseases related to gamma Sarcoglycan Antibody (NBP1-59744).

Pathways for gamma Sarcoglycan Antibody (NBP1-59744)

View related products by pathway.

Blogs on gamma Sarcoglycan

There are no specific blogs for gamma Sarcoglycan, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IHC-Fr
Species: Mouse

Application: WB
Species: Mouse


Gene Symbol SGCG