gamma Sarcoglycan Antibody

Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse protein. Image from verified customer review.

Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744] - Mouse tibialis anterior frozen sections. Image from verified customer review.

Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Human Heart lysate, concentration 1.25ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IHC-Fr
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

gamma Sarcoglycan Antibody Summary

• Immunogen: Synthetic peptides corresponding to SGCG(sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)) The peptide sequence was selected from the middle region of SGCG. Peptide sequence FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SGCG
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:10-1:500
• Application Notes: This is a rabbit polyclonal antibody against SGCG and was validated on Western blot. Frozen section data from customer review.
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for gamma Sarcoglycan Antibody

• 35 kDa dystrophin-associated glycoprotein
• 35DAG
• A4
• DAGA4,35kD dystrophin-associated glycoprotein
• DMDA
• DMDA1
• gamma sarcoglycan
• gamma-sarcoglycan
• gamma-SG
• MAM
• MGC130048
• sarcoglycan, gamma (35kD dystrophin-associated glycoprotein)
• sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
• SCARMD2
• SCG3LGMD2C
• TYPE

Background

Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for gamma Sarcoglycan Antibody (NBP1-59744)(1)

Publication using NBP1-59744

• Chrzanowski SM, Vohra RS, Lee-McMullen BA et al. Contrast-Enhanced Near-Infrared Optical Imaging Detects Exacerbation and Amelioration of Murine Muscular Dystrophy. Mol Imaging 2017 Dec 23 [PMID: 29271299] (WB, Mouse)

Reviews for gamma Sarcoglycan Antibody (NBP1-59744) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Mouse.

reviewed by: Anonymous IHC-Fr Mouse 08/28/2014

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Mouse tibialis anterior
• Species: Mouse

Blocking

• Blocking Details: Goat Normal Serum, 15 min, room temperature

Primary Anitbody

• Dilution Ratio: 1:50, 60min at 37C

Secondary Antibody

• Secondary Description: goat anti rabbit IgF-FITC
• Secondary Manufacturer Cat#: Sigma F9887
• Secondary Concentration: 1:300

Details

• Detection Notes: Image at 20x, Olympus B-65 Microscope/Camera
• Fixation Details: Cut section at 5um, adhered to charged slide. 1) PBS 3x for 5min each 2) 1% Triton for 20min 3)PBS 3x 5min each; all room temp
• Wash Description: PBS 3x, 5min each.

reviewed by: Anonymous WB Mouse 08/13/2014

Summary

• Application: Western Blot
• Sample Tested: Mouse Heart, Liver, Quadriceps, and Triceps
• Species: Mouse
• Lot: QC17604-100331
• Comments: Increasing exposure time to ~24 hours did increase signal, but also increased background. Increasing the secondary antibody dilution may help lower background at high exposure times.

Blocking

• Blocking Details: 5% Milk, TBS-Tween 0.1%, 1 hour 4C

Primary Anitbody

• Dilution Ratio: 1:1000 in 5% Milk, TBS-Tween 0.1%. Incubated overnight (~14 hrs) at 4C

Secondary Antibody

• Secondary Description: Donkey anti-rabbit, HRP
• Secondary Manufacturer Cat#: Santa Cruz, sc-2305
• Secondary Concentration: 1:10,000

Details

• Detection Notes: Pierce ECL Western Blotting Substrat, # 32106. Exposure time 2 hours.

Comments

• Comments: Increasing exposure time to ~24 hours did increase signal, but also increased background. Increasing the secondary antibody dilution may help lower background at high exposure times.

Bioinformatics

• Gene Symbol: SGCG
• Uniprot:
  • Q13326(Human)