Reactivity | Hu, MuSpecies Glossary |
Applications | WB, IHC, IHC-Fr |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to SGCG(sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)) The peptide sequence was selected from the middle region of SGCG. Peptide sequence FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SGCG |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against SGCG and was validated on Western blot. Frozen section data from customer review. |
|
Theoretical MW | 32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Protein A purified |
Publication using NBP1-59744 | Applications | Species |
---|---|---|
Chrzanowski SM, Vohra RS, Lee-McMullen BA et al. Contrast-Enhanced Near-Infrared Optical Imaging Detects Exacerbation and Amelioration of Murine Muscular Dystrophy. Mol Imaging 2017 Dec 23 [PMID: 29271299] (WB, Mouse) | WB | Mouse |
Images | Ratings | Applications | Species | Date | Details | ||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Mouse | 08/28/2014 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
|
||||||||||||||||||||||||
![]() Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 08/13/2014 |
Summary
Blocking
Primary Anitbody
Secondary Antibody
Details
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for gamma Sarcoglycan Antibody (NBP1-59744)Discover more about diseases related to gamma Sarcoglycan Antibody (NBP1-59744).
| Pathways for gamma Sarcoglycan Antibody (NBP1-59744)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Verified Customer 08/28/2014 |
||
Application: | IHC-Fr | |
Species: | Mouse |
Verified Customer 08/13/2014 |
||
Application: | WB | |
Species: | Mouse |