GALM Antibody

Images

 
Western Blot: GALM Antibody [NBP2-38252] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue
Immunocytochemistry/ Immunofluorescence: GALM Antibody [NBP2-38252] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human cerebral cortex.
Immunohistochemistry: GALM Antibody [NBP2-38252] - Staining of human fallopian tube shows moderate cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human skin shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining in human kidney and skin tissues using anti-GALM antibody. Corresponding GALM RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human adrenal gland, cerebral cortex, kidney and skin using Anti-GALM antibody NBP2-38252 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human adrenal gland.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GALM Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GALM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GALM Protein (NBP2-38252PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GALM Antibody

  • aldose 1-epimerase
  • BLOCK 25
  • EC 5.1.3.3
  • galactomutarotase
  • galactose mutarotase (aldose 1-epimerase)
  • Galactose mutarotase
  • IBD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-81853
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP1-82693
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP2-03390
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-47559
Species: Hu
Applications: IHC, IHC-P, WB
H00002592-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00006583-A01
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
6507-IL/CF
Species: Hu
Applications: BA
NB100-56152
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
2526-IL/CF
Species: Hu
Applications: BA
NBP3-17138
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
AF5447
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP2-38252
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GALM Antibody (NBP2-38252) (0)

There are no publications for GALM Antibody (NBP2-38252).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALM Antibody (NBP2-38252) (0)

There are no reviews for GALM Antibody (NBP2-38252). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GALM Antibody (NBP2-38252) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GALM Products

Bioinformatics Tool for GALM Antibody (NBP2-38252)

Discover related pathways, diseases and genes to GALM Antibody (NBP2-38252). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALM Antibody (NBP2-38252)

Discover more about diseases related to GALM Antibody (NBP2-38252).
 

Pathways for GALM Antibody (NBP2-38252)

View related products by pathway.

PTMs for GALM Antibody (NBP2-38252)

Learn more about PTMs related to GALM Antibody (NBP2-38252).
 

Research Areas for GALM Antibody (NBP2-38252)

Find related products by research area.

Blogs on GALM

There are no specific blogs for GALM, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GALM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GALM
Uniprot