Galectin-3BP/MAC-2BP/LGALS3BP Antibody - BSA Free

Western Blot: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Analysis in human cell lines SK-MEL-30 and MCF-7 using anti-LGALS3BP antibody. Corresponding LGALS3BP RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.

Immunohistochemistry-Paraffin: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Galectin-3BP/MAC-2BP/LGALS3BP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Galectin-3BP/MAC-2BP/LGALS3BP Antibody - BSA Free (NBP1-89346) is a polyclonal antibody validated for use in IHC and WB. Anti-Galectin-3BP/MAC-2BP/LGALS3BP Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LGALS3BP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Galectin-3BP/MAC-2BP/LGALS3BP Protein (NBP1-89346PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Galectin-3BP/MAC-2BP/LGALS3BP Antibody - BSA Free

• 90K
• Basement membrane autoantigen p105
• BTBD17B
• galectin-3-binding protein
• Galectin3BP
• Galectin-3BP
• L3 antigen
• Lectin galactoside-binding soluble 3-binding protein
• lectin, galactoside-binding, soluble, 3 binding protein
• LGALS3BP
• M2BP
• Mac-2 BP
• Mac-2-binding protein
• MAC2BP
• MAC-2BP
• MAC-2-BP
• serum protein 90K
• Tumor-associated antigen 90K

Background

Plasmid: pCMV-LGALS3BP Full length

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346)(4)

Publications using NBP1-89346

• Kimura, R, Yoshimaru, T Et al. The GALNT6 LGALS3BP axis promotes breast cancer cell growth. Int J Oncol 2020-02-01 [PMID: 31894262] (WB, Human)
• Endo H, Muramatsu T, Furuta M et al. Potential of tumor-suppressive miR-596 targeting LGALS3BP as a therapeutic agent in oral cancer Carcinogenesis 2012-12-10 [PMID: 23233740] (WB, Human)
• Block AS, Saraswati S, Lichti CF et al. Co-purification of Mac-2 binding protein with galectin-3 and association with prostasomes in human semen. Prostate 2011-05-01 [PMID: 21031433]
• Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965]

Bioinformatics

• Gene Symbol: LGALS3BP