Galectin-3BP/MAC-2BP/LGALS3BP Antibody

Images

 
Western Blot: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-LGALS3BP antibody. Corresponding LGALS3BP RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Galectin-3BP/MAC-2BP/LGALS3BP Antibody [NBP1-89346] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Galectin-3BP/MAC-2BP/LGALS3BP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LGALS3BP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Galectin-3BP/MAC-2BP/LGALS3BP Protein (NBP1-89346PEP)
Publications
Read Publications using
NBP1-89346 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Galectin-3BP/MAC-2BP/LGALS3BP Antibody

  • 90K
  • Basement membrane autoantigen p105
  • BTBD17B
  • galectin-3-binding protein
  • Galectin3BP
  • Galectin-3BP
  • L3 antigen
  • Lectin galactoside-binding soluble 3-binding protein
  • lectin, galactoside-binding, soluble, 3 binding protein
  • LGALS3BP
  • M2BP
  • Mac-2 BP
  • Mac-2-binding protein
  • MAC2BP
  • MAC-2BP
  • MAC-2-BP
  • serum protein 90K
  • Tumor-associated antigen 90K

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00010146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi SP
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
870-LP/CF
Species: Hu
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346)(3)

Reviews for Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346) (0)

There are no reviews for Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Galectin-3BP/MAC-2BP/LGALS3BP Products

Bioinformatics Tool for Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346)

Discover related pathways, diseases and genes to Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346)

Discover more about diseases related to Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346).
 

Pathways for Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346)

View related products by pathway.

PTMs for Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346)

Learn more about PTMs related to Galectin-3BP/MAC-2BP/LGALS3BP Antibody (NBP1-89346).

Blogs on Galectin-3BP/MAC-2BP/LGALS3BP

There are no specific blogs for Galectin-3BP/MAC-2BP/LGALS3BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Galectin-3BP/MAC-2BP/LGALS3BP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LGALS3BP
Entrez