Galectin-1 Antibody - BSA Free

Western Blot: Galectin-1 Antibody [NBP1-59002] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Immunohistochemistry-Paraffin: Galectin-1 Antibody [NBP1-59002] - Galectin 1 Antibody [NBP1-59002] - Human placenta tissue at an antibody concentration of 5ug/ml.

Western Blot: Galectin-1 Antibody [NBP1-59002] - Galectin 1 Antibody [NBP1-59002] - Mouse macrophages.

Immunohistochemistry-Paraffin: Galectin-1 Antibody [NBP1-59002] - Galectin 1 Antibody [NBP1-59002] - Human Placenta tissue 5ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Galectin-1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to LGALS1 (lectin, galactoside-binding, soluble, 1 (galectin-1)) The peptide sequence was selected from the middle region of LGALS1. Peptide sequence EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LGALS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Galectin-1 Antibody - BSA Free

• 14 kDa laminin-binding protein
• 14 kDa lectin
• Beta-galactoside-binding lectin L-14-I
• BHL
• DKFZp686E23103
• GAL1
• gal-1
• Galaptin
• galectin 1
• Galectin1
• Galectin-1
• GBP
• HBL
• HLBP14
• HPL
• L-14
• Lactose-binding lectin 1
• Lectin galactoside-binding soluble 1
• lectin, galactoside-binding, soluble, 1
• LGALS1
• Putative MAPK-activating protein PM12
• S-Lac lectin 1

Background

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LGALS1
• Uniprot:
  • P09382()