GALE Antibody

Images

 
Western Blot: GALE Antibody [NBP1-87066] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: GALE Antibody [NBP1-87066] - Staining of human cell line A-431 shows localization to nucleus, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: GALE Antibody [NBP1-87066] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: GALE Antibody [NBP1-87066] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GALE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAA
Specificity
Specificity of human, mouse, rat GALE antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GALE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GALE Protein (NBP1-87066PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87066 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GALE Antibody

  • EC 5.1.3
  • EC 5.1.3.2
  • FLJ95174
  • FLJ97302
  • Galactowaldenase
  • short chain dehydrogenase/reductase family 1E, member 1
  • UDP galactose-4'-epimerase
  • UDP-
  • UDP-galactose 4-epimerase
  • UDP-galactose-4-epimerase
  • UDP-glucose 4-epimerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-98673
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GALE Antibody (NBP1-87066) (0)

There are no publications for GALE Antibody (NBP1-87066).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for GALE Antibody (NBP1-87066) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-87066:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot GALE NBP1-87066
Enlarge
reviewed by:
Anonymous
WB Human 06/17/2015
View

Summary

ApplicationWestern Blot
Sample Testedhela whole cell lysate, primary hepatocyte lysate
SpeciesHuman

Blocking

Blocking DetailsOdyssey blocking buffer, 2 hours, RT

Primary Anitbody

Dilution Ratio1:500, incubated overnoght at 4 degrees in Odyssey buffer

Secondary Antibody

Secondary DescriptionGoat anti rabbit, IRD
Secondary Concentration1:10000

Details

Detection NotesFluorescent detection

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GALE Antibody (NBP1-87066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GALE Products

Bioinformatics Tool for GALE Antibody (NBP1-87066)

Discover related pathways, diseases and genes to GALE Antibody (NBP1-87066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALE Antibody (NBP1-87066)

Discover more about diseases related to GALE Antibody (NBP1-87066).
 

Pathways for GALE Antibody (NBP1-87066)

View related products by pathway.

PTMs for GALE Antibody (NBP1-87066)

Learn more about PTMs related to GALE Antibody (NBP1-87066).
 

Research Areas for GALE Antibody (NBP1-87066)

Find related products by research area.

Blogs on GALE

There are no specific blogs for GALE, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
06/17/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol GALE