GAK Antibody


Immunohistochemistry: GAK Antibody [NBP1-86389] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neurons.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

GAK Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFH
Specificity of human GAK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GAK Protein (NBP1-86389PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GAK Antibody

  • Auxillin 2
  • cyclin G associated kinase
  • cyclin-G-associated kinase
  • EC
  • FLJ16629
  • FLJ40395
  • GAK
  • MGC99654


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Mu
Applications: WB, IHC, IP
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for GAK Antibody (NBP1-86389) (0)

There are no publications for GAK Antibody (NBP1-86389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAK Antibody (NBP1-86389) (0)

There are no reviews for GAK Antibody (NBP1-86389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GAK Antibody (NBP1-86389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GAK Products

Bioinformatics Tool for GAK Antibody (NBP1-86389)

Discover related pathways, diseases and genes to GAK Antibody (NBP1-86389). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAK Antibody (NBP1-86389)

Discover more about diseases related to GAK Antibody (NBP1-86389).

Pathways for GAK Antibody (NBP1-86389)

View related products by pathway.

PTMs for GAK Antibody (NBP1-86389)

Learn more about PTMs related to GAK Antibody (NBP1-86389).

Research Areas for GAK Antibody (NBP1-86389)

Find related products by research area.

Blogs on GAK

There are no specific blogs for GAK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GAK Antibody and receive a gift card or discount.


Gene Symbol GAK