AAK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AAK1 Antibody [NBP1-84111] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84111] - Staining of human parathyroid gland shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AAK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQPKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAAAEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDDDNFSKLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AAK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AAK1 Protein (NBP1-84111PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AAK1 Antibody

  • AAK1
  • Adaptor-associated kinase 1
  • AP2 associated kinase 1
  • AP2-associated protein kinase 1
  • DKFZp686F03202
  • DKFZp686K16132
  • EC 2.7.11.1
  • FLJ23712
  • FLJ25931
  • FLJ31060
  • FLJ45252
  • KIAA1048FLJ42882
  • MGC138170
  • MGC164568
  • MGC164570

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89441
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
NBP2-00834
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-55000
Species: Hu
Applications: ICC/IF
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1085
Species: Mu
Applications: WB, IHC, Neut
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84111
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AAK1 Antibody (NBP1-84111) (0)

There are no publications for AAK1 Antibody (NBP1-84111).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AAK1 Antibody (NBP1-84111) (0)

There are no reviews for AAK1 Antibody (NBP1-84111). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AAK1 Antibody (NBP1-84111) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AAK1 Products

Bioinformatics Tool for AAK1 Antibody (NBP1-84111)

Discover related pathways, diseases and genes to AAK1 Antibody (NBP1-84111). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AAK1 Antibody (NBP1-84111)

Discover more about diseases related to AAK1 Antibody (NBP1-84111).
 

Pathways for AAK1 Antibody (NBP1-84111)

View related products by pathway.

PTMs for AAK1 Antibody (NBP1-84111)

Learn more about PTMs related to AAK1 Antibody (NBP1-84111).

Blogs on AAK1

There are no specific blogs for AAK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AAK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AAK1
Entrez