AAK1 Antibody

Immunocytochemistry/Immunofluorescence: AAK1 Antibody [NBP1-84111] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.

Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84111] - Staining of human lymph node.

Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84111] - Staining of human parathyroid gland shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84111] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84111] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84111] - Staining in human parathyroid gland and pancreas tissues using anti-AAK1 antibody. Corresponding AAK1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84111] - Staining of human colon, liver, lymph node and parathyroid gland using Anti-AAK1 antibody NBP1-84111 (A) shows similar protein distribution across tissues to independent antibody NBP1-84110 (B).

Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84111] - Staining of human colon.

Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84111] - Staining of human liver.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

AAK1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQPKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAAAEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDDDNFSKLT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AAK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AAK1 Protein (NBP1-84111PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AAK1 Antibody

• AAK1
• Adaptor-associated kinase 1
• AP2 associated kinase 1
• AP2-associated protein kinase 1
• DKFZp686F03202
• DKFZp686K16132
• EC 2.7.11.1
• FLJ23712
• FLJ25931
• FLJ31060
• FLJ45252
• KIAA1048FLJ42882
• MGC138170
• MGC164568
• MGC164570

Background

AAK1 (AP2-associated kinase 1) is a Ser/Thr protein kinase. The rat homolog was first identified in a screen of a rat brain cDNA library using a domain of the alpha subunit of the heterotetrameric AP2 complex as bait. The AP2 complex is one of two major coat proteins of endocytic vesicles that function in receptor-mediated endocytosis and the recycling of synaptic vesicles. AAK1 is responsible for phosphorylating the mu subunit of AP2 to promote clathrin-mediated endocytosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AAK1