GADD45G Antibody - BSA Free

Western Blot: GADD45G Antibody [NBP3-35120] - Western blot analysis of lysates from RAW264.7 cells, using GADD45G Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5min.

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Mouse pancreas tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: GADD45G Antibody [NBP3-35120] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using GADD45G Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GADD45G Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GADD45G Antibody - BSA Free (NBP3-35120) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1).
  
  Sequence:
  IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GADD45G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:200 - 1:2000
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for GADD45G Antibody - BSA Free

• CR6DNA damage-inducible transcript 2 protein
• Cytokine-responsive protein CR6
• DDIT-2
• DDIT2GADD45-gamma
• growth arrest and DNA damage-inducible protein GADD45 gamma
• growth arrest and DNA-damage-inducible, gamma
• GRP1717 kD

Background

GADD45G is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GADD45G