Recombinant Human GABARAPL1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GABARAPL1 Peptides and Proteins

Order Details


    • Catalog Number
      P3417
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GABARAPL1 Protein Summary

Description
A full-length recombinant protein with His tag corresponding to the amino acids 1 - 117 of Human GABARAPL1

Source: Escherichia coli

Amino Acid Sequence:MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Preparation
Method
Escherichia coli expression system
Protein/Peptide Type
Recombinant Protein
Gene
GABARAPL1

Applications/Dilutions

Dilutions
  • SDS-Page
Application Notes
This product is useful for SDS-PAGE.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
In 20 mM Tris buffer, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GABARAPL1 Protein

  • APG8L
  • APG8-LIKE
  • ATG8
  • ATG8B
  • ATG8L
  • Early estrogen-regulated protein
  • GABA(A) receptor-associated protein like 1
  • GABARAPL1
  • gamma-aminobutyric acid receptor-associated protein-like 1
  • GEC1
  • GEC-1
  • GEC1GABA(A) receptor-associated protein-like 1
  • Glandular epithelial cell protein 1

Background

Ubiquitin-like proteins fall into two classes: the first class, ubiquitin-like modifiers (UBLs)function as modifiers in a manner analogous to that of ubiquitin. Examples of UBLs are SUMO, Rub1 (also called Nedd8), Apg8 and Apg12. Proteins of the second class include parkin, RAD23 and DSK2, are designated ubiquitin-domain proteins (UDPs). These proteins contain domains that are related to ubiquitin but are otherwise unrelated to each other. In contrast to UBLs, UDPs are not conjugated to other proteins. Apg8 is required for autophagy (intracellular bulk protein degradation) in yeast. Starved yeast cells take up their own cytoplasm into vacuoles through autophagic bodies. Autophagic bodies form a double-membraned structure called the autophagosome,which subsequently fuses with the vacuole/lysosome. This process similar in mammals. Two sets of genes, APG and AUT, have been identified with this process, and are responsible for two ubiquitin-like systems Apg12 and Apg8, respectively. Apg12 is synthesized in its mature form and seems to have one target, Apg5. Almost all Apg12 molecules are conjugated with Apg5. Aut2/Apg4 processes the Apg8/Aut7 system at its carboxy-terminal region. Apg8 exists in two forms, one is membrane bound through a phospholipid. Lipidation/ activation of Apg8 is mediated by Apg7 and transferred to Apg3 and finally forms a conjugate with phosphatidyl-ethanolamine (PE). Apg4 cleaves Apg8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-71771
Species: Dr, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15501
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB
NBP2-01083
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-24709
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-38363
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-2220
Species: Al, Av, Ba, Bv, Ca, Ch, ChHa, SyHa, Gp, Ha, Hu, In, Pm, Mu, Po, Pm, Rb, Rt, Ze
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, PAGE, Simple Western, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for GABARAPL1 Recombinant Protein (P3417) (0)

There are no publications for GABARAPL1 Recombinant Protein (P3417).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABARAPL1 Recombinant Protein (P3417) (0)

There are no reviews for GABARAPL1 Recombinant Protein (P3417). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GABARAPL1 Recombinant Protein (P3417) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GABARAPL1 Products

Research Areas for GABARAPL1 Recombinant Protein (P3417)

Find related products by research area.

Blogs on GABARAPL1.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GABARAPL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GABARAPL1