Prolyl Oligopeptidase/PREP Antibody

Images

 
Western Blot: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody stainin is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Staining in human colon and pancreas tissues using anti-PREP antibody. Corresponding PREP RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Staining of human colon shows high expression.
Immunohistochemistry-Paraffin: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Prolyl Oligopeptidase/PREP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKD
Specificity
Specificity of human Prolyl Oligopeptidase/PREP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PREP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
Prolyl Oligopeptidase/PREP Knockout 293T Cell Lysate
Control Peptide
Prolyl Oligopeptidase/PREP Protein (NBP2-33950PEP)
Publications
Read Publications using
NBP2-33950 in the following applications:

  • WB
    2 publications

Reactivity Notes

Rat (86%). Use in Mouse reported in scientific literature (PMID:31786979).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Prolyl Oligopeptidase/PREP Antibody

  • dJ355L5.1 (prolyl endopeptidase)
  • EC 3.4.21.26
  • MGC16060
  • PE
  • PEP
  • Post-proline cleaving enzyme
  • PREP
  • prolyl endopeptidase
  • Prolyl Oligopeptidase
  • rPop

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-23368
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP2-95244
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
7270-IL/CF
Species: Hu
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-38958
Species: Hu
Applications: IHC, IHC-P

Publications for Prolyl Oligopeptidase/PREP Antibody (NBP2-33950)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Mouse
(2)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP2-33950 Applications Species
Serfozo P, Wysocki J, Gulua G, et al. Ang II (Angiotensin II) Conversion to Angiotensin-(1-7) in the Circulation Is POP (Prolyloligopeptidase)-Dependent and ACE2 (Angiotensin-Converting Enzyme 2)-Independent. Hypertension 2019 Dec 2 [PMID: 31786979] (WB, Mouse) WB Mouse
Serfozo PD Angiotensin-Converting Enzyme 2-and Prolyl Carboxypeptidase-Independent Conversion of Angiotensin II to Angiotensin-(1-7) in Circulation and Peripheral Tissues Thesis Jan 1 2020 (WB, Mouse) WB Mouse

Reviews for Prolyl Oligopeptidase/PREP Antibody (NBP2-33950) (0)

There are no reviews for Prolyl Oligopeptidase/PREP Antibody (NBP2-33950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Prolyl Oligopeptidase/PREP Antibody (NBP2-33950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Prolyl Oligopeptidase/PREP Products

Bioinformatics Tool for Prolyl Oligopeptidase/PREP Antibody (NBP2-33950)

Discover related pathways, diseases and genes to Prolyl Oligopeptidase/PREP Antibody (NBP2-33950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prolyl Oligopeptidase/PREP Antibody (NBP2-33950)

Discover more about diseases related to Prolyl Oligopeptidase/PREP Antibody (NBP2-33950).
 

Pathways for Prolyl Oligopeptidase/PREP Antibody (NBP2-33950)

View related products by pathway.

PTMs for Prolyl Oligopeptidase/PREP Antibody (NBP2-33950)

Learn more about PTMs related to Prolyl Oligopeptidase/PREP Antibody (NBP2-33950).

Blogs on Prolyl Oligopeptidase/PREP

There are no specific blogs for Prolyl Oligopeptidase/PREP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Prolyl Oligopeptidase/PREP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PREP
Uniprot