Prolyl Oligopeptidase/PREP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody stainin is shown in green.

Immunohistochemistry-Paraffin: Prolyl Oligopeptidase/PREP Antibody [NBP2-33950] - Staining of human pancreas shows low expression as expected.

Staining of human Rectum shows moderate cytoplasmic positivity in glandular cells.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Analysis in human cell line K562.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Prolyl Oligopeptidase/PREP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Prolyl Oligopeptidase/PREP Antibody - BSA Free (NBP2-33950) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Prolyl Oligopeptidase/PREP Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PREP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Prolyl Oligopeptidase/PREP Protein (NBP2-33950PEP)

Reactivity Notes

Rat (86%). Use in Mouse reported in scientific literature (PMID:31786979).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Prolyl Oligopeptidase/PREP Antibody - BSA Free

• dJ355L5.1 (prolyl endopeptidase)
• EC 3.4.21.26
• MGC16060
• PE
• PEP
• Post-proline cleaving enzyme
• PREP
• prolyl endopeptidase
• Prolyl Oligopeptidase
• rPop

Background

The protein encoded by the Prolyl Endopeptidase gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Prolyl Oligopeptidase/PREP Antibody (NBP2-33950)(3)

Publications using NBP2-33950

• Serfozo PD Angiotensin-Converting Enzyme 2-and Prolyl Carboxypeptidase-Independent Conversion of Angiotensin II to Angiotensin-(1-7) in Circulation and Peripheral Tissues Thesis 2020-01-01 (WB, Mouse)
• Serfozo P, Wysocki J, Gulua G, et al. Ang II (Angiotensin II) Conversion to Angiotensin-(1-7) in the Circulation Is POP (Prolyloligopeptidase)-Dependent and ACE2 (Angiotensin-Converting Enzyme 2)-Independent. Hypertension 2019-12-02 [PMID: 31786979] (WB, Mouse)
• Romero CA, Kumar N, Nakagawa P et al. Renal release of Ac-SDKP is part of an antifibrotic peptidergic system in the kidney. Am J Physiol Renal Physiol 2018-11-07 [PMID: 30403163]

Bioinformatics

• Gene Symbol: PREP
• Uniprot:
  • P48147()