| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PREP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP2-33950 | Applications | Species |
|---|---|---|
| Serfozo PD Angiotensin-Converting Enzyme 2-and Prolyl Carboxypeptidase-Independent Conversion of Angiotensin II to Angiotensin-(1-7) in Circulation and Peripheral Tissues Thesis 2020-01-01 (WB, Mouse) | WB | Mouse |
| Serfozo P, Wysocki J, Gulua G, et al. Ang II (Angiotensin II) Conversion to Angiotensin-(1-7) in the Circulation Is POP (Prolyloligopeptidase)-Dependent and ACE2 (Angiotensin-Converting Enzyme 2)-Independent. Hypertension 2019-12-02 [PMID: 31786979] (WB, Mouse) | WB | Mouse |
| Romero CA, Kumar N, Nakagawa P et al. Renal release of Ac-SDKP is part of an antifibrotic peptidergic system in the kidney. Am J Physiol Renal Physiol 2018-11-07 [PMID: 30403163] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.