GABA-AR alpha 2 Antibody - BSA Free

Western Blot: GABA-AR alpha 2 Antibody [NBP3-02985] - Analysis of extracts of various cell lines, using GABA-AR alpha 2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

Immunohistochemistry-Paraffin: GABA-AR alpha 2 Antibody [NBP3-02985] - Immunohistochemistry of paraffin-embedded mouse stomach using GABA-AR alpha 2 Rabbit pAb (NBP3-02985) at dilution of 1:250 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GABA-AR alpha 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GABA-AR alpha 2 Antibody - BSA Free (NBP3-02985) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA-AR alpha 2 (NP_000798.2). ARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABRA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GABA-AR alpha 2 Antibody - BSA Free

• GABA A R alpha 2
• GABA(A) receptor subunit alpha-2
• GABAAR alpha 2
• GABAARa2
• GABRA2
• gamma-aminobutyric acid (GABA) A receptor, alpha 2
• gamma-aminobutyric acid receptor subunit alpha-2

Background

GABA (A) receptors are ligand-gated chloride channels that play a role as inhibitory neurotransmitters. They are known targets for certain classes of environmental and pharmaceutical compounds because a number of drugs interact with binding sites on GABA (A). Some of these drugs include benzodiazepines, anticonvulsants, and anesthetics. GABA (A) Receptors are comprised of subunits and these are further classified into 3 major groups (alpha, beta, and gamma). The subunits determine the pharmacological characteristics.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABRA2