GABA-A R gamma 3 Antibody

Images

 
Immunohistochemistry-Paraffin: GABA-A R gamma 3 Antibody [NBP2-30464] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GABA-A R gamma 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABRG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GABA-A R gamma 3 Protein (NBP2-30464PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GABA-A R gamma 3 Antibody

  • GABA A R gamma 3
  • GABA(A) receptor subunit gamma-3
  • GABAAR gamma 3
  • GABAARg3
  • GABRG3
  • gamma-aminobutyric acid (GABA) A receptor, gamma 3
  • gamma-aminobutyric acid receptor subunit gamma-3

Background

GABAA receptor, subunit gamma 3, is the ligand-gated ion channel through which GABAA (gamma-aminobutyric acid) exerts its inhibitory neurotransmitter function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GABA-A R gamma 3 Antibody (NBP2-30464) (0)

There are no publications for GABA-A R gamma 3 Antibody (NBP2-30464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R gamma 3 Antibody (NBP2-30464) (0)

There are no reviews for GABA-A R gamma 3 Antibody (NBP2-30464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GABA-A R gamma 3 Antibody (NBP2-30464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GABA-A R gamma 3 Products

Research Areas for GABA-A R gamma 3 Antibody (NBP2-30464)

Find related products by research area.

Blogs on GABA-A R gamma 3

There are no specific blogs for GABA-A R gamma 3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA-A R gamma 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRG3
Uniprot