G3BP2 Antibody

Images

 
Western Blot: G3BP2 Antibody [NBP2-84947] - Host: Rabbit. Target Name: G3BP2. Sample Type: 293T Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G3BP2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human G3BP2. Peptide sequence: QRPRERPGFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDID The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
G3BP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for G3BP2 Antibody

  • G3BP-2
  • GAP SH3 domain-binding protein 2
  • GTPase activating protein (SH3 domain) binding protein 2
  • KIAA0660
  • ras GTPase-activating protein-binding protein 2
  • Ras-GTPase activating protein SH3 domain-binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-18922
Species: Hu, Mu, Ma
Applications: WB, ICC/IF, IP
AF5094
Species: Hu, Mu, Rt
Applications: WB
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP1-84339
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-52813
Species: Hu
Applications: WB, ICC/IF
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB200-191
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-26393
Species: Hu
Applications: WB, ICC/IF
NBP1-20863
Species: Hu
Applications: WB, IHC, IHC-P, IP, PEP-ELISA
NBP3-05186
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF2000
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready

Publications for G3BP2 Antibody (NBP2-84947) (0)

There are no publications for G3BP2 Antibody (NBP2-84947).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G3BP2 Antibody (NBP2-84947) (0)

There are no reviews for G3BP2 Antibody (NBP2-84947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G3BP2 Antibody (NBP2-84947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional G3BP2 Products

Bioinformatics Tool for G3BP2 Antibody (NBP2-84947)

Discover related pathways, diseases and genes to G3BP2 Antibody (NBP2-84947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G3BP2 Antibody (NBP2-84947)

Discover more about diseases related to G3BP2 Antibody (NBP2-84947).
 

Pathways for G3BP2 Antibody (NBP2-84947)

View related products by pathway.

PTMs for G3BP2 Antibody (NBP2-84947)

Learn more about PTMs related to G3BP2 Antibody (NBP2-84947).

Blogs on G3BP2

There are no specific blogs for G3BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G3BP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol G3BP2